KEGG   Equus caballus (horse): 100067414Help
Entry
100067414         CDS       T01058                                 

Gene name
IMPAD1
Definition
inositol monophosphatase domain containing 1
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
ecb  Equus caballus (horse)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100067414 (IMPAD1)
  Energy metabolism
   00920 Sulfur metabolism
    100067414 (IMPAD1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100067414 (IMPAD1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100067414 (IMPAD1)
    3.1.3.25  inositol-phosphate phosphatase
     100067414 (IMPAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 420 aa AA seqDB search
MENEAGFMWPRDREPPLADLEFHPAPLQLQTLRGSLCAVIKFKAIVSVLTPFLRGRALIG
QTKVMNSRLIESEVEVKVCGYGDCWNFMLLRKPNYVLLITETRRFFTVRKQLPPHPGVIS
EPEYRRNPTKRRGAVQHCRVHEAYRSAPKVAPPRGRSLTRPAPLPAPLPGNVLSIYKMFY
LLKTTFPTVQINTEEHVDATDQEVILWDRKIPEDILKEIAAPKEVPAESVTVWIDPLDAT
QEYTEDLRKYVTTMVCVAVNGKPVLGVIHKPFSKYTAWAMVDGGSNVKARTSYNEKTPRI
VVSRSHSGMVKQVALQTFGNQTTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIKKW
DICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASISMNHQALVRKLPDLEKTGHK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgaagcaggcttcatgtggcccagggacagagagccaccactggccgacctg
gagtttcatccagccccgctacaactgcagactctccgtggctcactctgtgctgtcatc
aagttcaaggctattgtcagtgtcctcacaccctttctcagaggaagggcactcatcggg
cagactaaagttatgaattcaaggctgatagagtccgaagtggaagtgaaagtctgtgga
tatggagactgctggaatttcatgttactaaggaaacccaattatgtgttactcatcacc
gaaactcggcgtttcttcacagtgagaaagcagctcccgccacatccaggagtgatctca
gaacccgaataccgccggaacccaaccaaacgacggggcgcggtccagcactgccgggtg
cacgaagcctaccgctctgcccccaaagtcgccccgccccgagggaggagccttacccgc
cccgcccctctccccgcccccttgccggggaacgtgctttctatctacaagatgttctac
ctgctcaagaccaccttccctacggtgcagataaatactgaggaacacgtggatgcaact
gatcaggaggttatcttatgggatcgtaagattcctgaggacatcctgaaggaaatagcc
gcccctaaagaggtaccagcggaaagtgttactgtgtggatcgacccacttgatgctaca
caggaatatacagaggatcttcgaaagtatgtcactactatggtgtgtgtggctgtaaat
ggtaaacctgtgctaggagtaatacataagccattttctaaatatacagcatgggcaatg
gtagatggtgggtcaaatgtgaaagcccgcacttcctacaatgagaagaccccaaggatc
gttgtgtctcgctcccattcaggaatggtcaaacaggttgctcttcagacttttggaaac
cagactacaattatcccagctggtggtgctggttataaagttttagcgctcttggatgtg
cctgataaaagtcaagaaaaagctgatctatatatccatgtgacatacatcaaaaagtgg
gatatatgtgctggcaatgccatcttaaaagcccttggggggcatatgactaccctgagt
ggtgaagaaatcagttatactggttccgacggcattgaaggaggtctgctcgctagcatc
agtatgaaccatcaggctctggtcagaaaactcccagatctcgagaagacaggacataaa
taa

DBGET integrated database retrieval system