KEGG   Equus caballus (horse): 100067486Help
Entry
100067486         CDS       T01058                                 

Gene name
GNB2
Definition
guanine nucleotide binding protein (G protein), beta polypeptide 2
Orthology
K04537  
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
ecb  Equus caballus (horse)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100067486 (GNB2)
   04151 PI3K-Akt signaling pathway
    100067486 (GNB2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    100067486 (GNB2)
  Nervous system
   04724 Glutamatergic synapse
    100067486 (GNB2)
   04727 GABAergic synapse
    100067486 (GNB2)
   04725 Cholinergic synapse
    100067486 (GNB2)
   04728 Dopaminergic synapse
    100067486 (GNB2)
   04726 Serotonergic synapse
    100067486 (GNB2)
   04723 Retrograde endocannabinoid signaling
    100067486 (GNB2)
  Environmental adaptation
   04713 Circadian entrainment
    100067486 (GNB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100067486 (GNB2)
  Substance dependence
   05032 Morphine addiction
    100067486 (GNB2)
   05034 Alcoholism
    100067486 (GNB2)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100067486 (GNB2)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100067486 (GNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggctgagcagctccggaaccagatccgggat
gcccgaaaagcatgtggggattcaacgctgacccagatcacagctgggctggacccagtg
gggaggatccagatgaggacacggaggaccctccgtgggcacctggcaaaaatctatgcc
atgcactgggggacagactcaaggctgctggtcagcgcctcccaggacgggaagctcatc
atctgggacagctacaccaccaacaaggtccatgccatcccactgcgctcctcctgggtc
atgacctgtgcctacgcgccctcagggaacttcgtggcctgtggggggttggacaacatc
tgctccatctacagcctcaagacccgtgagggcaatgtcagggtcagccgggagctgcct
ggccacactgggtacctgtcgtgctgccgcttcctggatgacaaccaaatcatcaccagc
tctggggacaccacctgtgctctgtgggacattgaaacaggccagcagacggtgggtttt
gctggacacagtggcgatgtgatgtccctgtcactggcccccgatggccgcacctttgtg
tcaggtgcctgcgacgcctccatcaagctgtgggacgtacgggattccatgtgccgacag
accttcattggccacgagtccgacatcaatgccgtggctttcttccccaatggctatgcc
ttcaccacgggttctgacgacgccacctgccgcctctttgacctgcgggccgaccaggag
ctccttatgtattcccacgacaacatcatctgtggcatcacctctgttgccttctcgcgc
agcggccggctgctgctcgctggctacgatgacttcaactgcaacatctgggatgccatg
aagggtgaccgtgctggtgtcctcgctggccacgacaaccgcgtgagctgcctcggggtc
actgacgatggcatggctgtggccacaggctcctgggactccttcctcaagatctggaac
taa

DBGET integrated database retrieval system