KEGG   Equus caballus (horse): 100067798Help
Entry
100067798         CDS       T01058                                 

Gene name
PLCZ1
Definition
phospholipase C, zeta 1
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100067798 (PLCZ1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100067798 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    100067798 (PLCZ1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100067798 (PLCZ1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100067798 (PLCZ1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100067798 (PLCZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 682 aa AA seqDB search
MTIKKFPSYKGVELITFGTHDNTERGETSKQGETEQQNFLNCFFCAHTWFLSMIRDDFRG
GKINLEKTQKLLEKLNIRCNYIHVKSIFKDNDRLKQGKITIEEFRSIYRIIAHREEVTEI
FNTYSENRKILLEKNLVQFLTQEQYSVEMTKTIASEIIEKYEPIEEVKQAHQMSLEGFTR
YMDSSECLLFDNKCERTYQNMNHPLNDYFISSSHNTYLISDQLVGPSDIWGYVSALVKGC
RCLEIDCWDGSQNEPVVYHGYTLTSKLLFKTVIQAIRKYAFITSDYPVVLSLENHCSPSQ
QEVIAHNLQSILGETLLSDVLDEFLDKLPSPEALKFKILVRNKKIGTLRETRERKGTDKH
GQIEEYEEVEETDQEDEDDDEVKESETEDILKDNQEKEMESKRVAGLPLFKKKRVKVAVA
LSDLVIYTKAEKFRSFQHSRLHQQFNESNSIGESKARKLSKLQAQEFILHTRKFITRIYP
KATRTDSSNFNPQEFWNIGCQMVALNFQTPGLPMDLQTGKFLDNGGSGYVLKPDFLRDNK
SKFNPNKAPIDSNPITLTIRLISGIQLPPSHHSSSNKADVIVIIELFGVPNDQAKHQTRV
IKKNAFSPRWNETFTFIIQVPELALIRFVVENQSLIAGNEFLGQYTLPVLCMNKGYRRVP
LFSKMGESLEPASLFLYVWYVR
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaagaaattcccttcctacaaaggggtagagttaattacatttggaacccat
gacaacaccgaaagaggagagacttctaagcaaggagaaacagaacagcagaatttcctt
aactgctttttttgtgctcatacgtggtttttgtcgatgattcgggatgactttagaggt
ggaaagattaacctagaaaaaactcagaaattacttgaaaagttaaatattcggtgcaat
tatattcatgtgaaaagtatttttaaggataatgacaggctgaagcaaggaaaaatcacc
atagaagaatttagatcaatttatcgaattattgcacacagagaagaagttactgagatt
ttcaacacatattctgaaaatcggaagattcttttggaaaaaaatctggtccaatttttg
acacaagagcagtattcagttgagatgactaaaactattgcctctgagatcattgaaaaa
tatgagcctattgaagaagttaagcaagcacaccagatgtcattagaaggttttacgaga
tacatggattcatctgaatgtctcttatttgataacaagtgtgaaagaacttatcaaaat
atgaatcatccattaaatgattattttatctcaagttcacataatacgtacttgatatct
gaccaattagtgggaccaagtgacatttggggatatgtaagtgcccttgtgaaaggatgc
cgttgtctggaaattgactgctgggatggatcgcaaaatgaacctgttgtataccatggt
tatacactcaccagcaagcttctgttcaaaactgttatccaagcgatacgcaaatatgcg
ttcattacctctgactacccggtggtgctctctttagaaaatcactgctccccttcccag
caagaagtgatagcacacaatttgcagtctattcttggagagaccttgctttctgatgtg
ctcgatgagtttcttgacaaactaccttcaccagaggcattaaaattcaaaatattagtt
agaaataagaaaatagggaccctaagggaaacccgtgaaagaaaaggtactgataagcac
ggtcagatagaggaatatgaagaagttgaagagacagatcaagaagatgaagatgatgat
gaagtcaaagaatcagaaacggaggatattttaaaagacaatcaagaaaaggaaatggag
tcaaaaagggtagctggcttaccacttttcaagaaaaagagggtaaaagtggctgtggcc
ctatctgatcttgtcatttatacgaaagccgagaaattcagaagctttcagcattcaaga
ctgcatcaacagtttaatgaaagtaattctattggggagtcaaaagcaagaaaactttca
aagttgcaagctcaagagtttattcttcacaccaggaagttcattaccagaatatatccc
aaagcaacgagaacagactcttctaattttaatcctcaagaattttggaatataggttgc
caaatggtggccttaaatttccagacccctggtctgcctatggaccttcaaactgggaaa
tttttggataatggtggttctggatatgttttgaaaccagacttcctaagagataataaa
tcaaagtttaacccaaataaagcaccaatagacagtaacccaattacacttacgataagg
ctcatcagtggtatccaattgcctcccagtcatcattcatcatctaacaaagctgacgta
atagtgattatagaactttttggtgttccaaatgatcaggcaaaacatcagactcgtgtg
attaaaaaaaacgcttttagtccaagatggaatgaaacattcacatttattattcaggtg
ccagaattggcgttgatacgttttgttgttgaaaatcaaagtttaatagctggaaatgaa
tttcttgggcaatatactttaccagttctatgcatgaacaaaggttatcgtcgtgttcct
ctgttttcgaaaatgggtgagagcctcgagcctgcttcactgtttctttacgtttggtac
gtcagatag

DBGET integrated database retrieval system