KEGG   Equus caballus (horse): 100067832Help
Entry
100067832         CDS       T01058                                 

Gene name
CLK1
Definition
CDC-like kinase 1
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
ecb  Equus caballus (horse)
Pathway
Legionellosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    100067832 (CLK1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100067832 (CLK1)
Protein kinases [BR:ecb01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100067832 (CLK1)
Spliceosome [BR:ecb03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100067832 (CLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 484 aa AA seqDB search
MRHSKRTYCPDWDEKDWDCGKWRSSSSHKRRKRSHSSARENKRCKYNHSKTSDSYYLESR
SLNEKDYHSRRYIDEYRNDYNQGCEPVHRHRDHESRYQNHSSKSSGRSGRSSYKSKHRIH
HSTSRHHSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECID
HKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPSSTFGCVQMLEWFEHHGHICIV
FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
YTEAYNPKMKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC
DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD
EHSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIEQMLEYDPAKRITLKEALKHPFFYPL
KKTI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagacactcgaaaagaacttattgtcctgattgggatgaaaaagattgggattgtgga
aaatggaggagcagtagcagtcataaaagaaggaagagatcacacagcagtgcccgggag
aacaagcgctgcaaatataatcactctaaaacatctgatagctattatttggaaagcaga
tccttaaatgagaaagattatcacagtcgacgctacattgatgaatacagaaatgactac
aatcaaggatgtgaacctgtacatcgccatagagaccatgaaagcagatatcagaatcat
agtagcaagtcctctggtagaagtggaagaagtagttataaaagcaaacacaggattcac
cacagtacttcacgtcatcattcacatgggaagagtcaccgaaggaaaagaaccaggagt
gtagaggatgatgaggagggtcacctgatctgtcagagtggagacgtactaagtgcaaga
tatgaaattgttgatactttaggtgaaggagcttttggaaaagtcgtggagtgcattgat
cataaagcgggaggtagacatgtagcagtaaaaatagttaaaaatgtggatagatattgt
gaagctgctcgctcagaaatacaagttctggaacacttaaatactacagaccccagcagt
acattcggctgtgtccagatgttggagtggtttgagcatcatggtcacatttgcattgtg
tttgaactgctaggacttagtacctatgatttcattaaagaaaatggttttctgccattt
cgactggaccatattaggaagatggcatatcagatatgcaagtctgtgaattttctgcac
agtaataagttgactcacacagacttaaagcctgaaaacatcttatttgtgcaatctgat
tacacagaggcttataatcccaaaatgaaacgtgatgaacgtaccttaataaatccagat
attaaagttgtagattttggcagtgcaacatatgatgatgaacatcacagtaccttggtc
tctacaagacattatagggcacctgaagttattttagccctaggatggtcccaaccatgt
gatgtctggagtattggatgtattcttatagaatactaccttgggtttacagtatttcca
acacatgatagtaaggagcacttagcaatgatggaaaggattcttggacctttaccaaaa
catatgatacagaaaaccaggaaacgtaaatatttccatcatgaccgattggactgggat
gaacatagttctgctgggagatatgtttcaaggcgctgtaagcctctgaaggaatttatg
ctttctcaagatgctgaacatgagctgctctttgacctcattgagcaaatgttggaatat
gatccagctaaaaggattactctcaaagaagccttaaagcatcctttcttttaccctcta
aaaaaaactatatag

DBGET integrated database retrieval system