KEGG   Equus caballus (horse): 100067832Help
Entry
100067832         CDS       T01058                                 

Gene name
CLK1
Definition
CDC-like kinase 1
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
ecb  Equus caballus (horse)
Pathway
Legionellosis
Class
Human Diseases; Infectious diseases; Legionellosis [PATH:ecb05134]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 484 aa AA seqDB search
MRHSKRTYCPDWDEKDWDCGKWRSSSSHKRRKRSHSSARENKRCKYNHSKTSDSYYLESR
SLNEKDYHSRRYIDEYRNDYNQGCEPVHRHRDHESRYQNHSSKSSGRSGRSSYKSKHRIH
HSTSRHHSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECID
HKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPSSTFGCVQMLEWFEHHGHICIV
FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
YTEAYNPKMKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC
DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD
EHSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIEQMLEYDPAKRITLKEALKHPFFYPL
KKTI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagacactcgaaaagaacttattgtcctgattgggatgaaaaagattgggattgtgga
aaatggaggagcagtagcagtcataaaagaaggaagagatcacacagcagtgcccgggag
aacaagcgctgcaaatataatcactctaaaacatctgatagctattatttggaaagcaga
tccttaaatgagaaagattatcacagtcgacgctacattgatgaatacagaaatgactac
aatcaaggatgtgaacctgtacatcgccatagagaccatgaaagcagatatcagaatcat
agtagcaagtcctctggtagaagtggaagaagtagttataaaagcaaacacaggattcac
cacagtacttcacgtcatcattcacatgggaagagtcaccgaaggaaaagaaccaggagt
gtagaggatgatgaggagggtcacctgatctgtcagagtggagacgtactaagtgcaaga
tatgaaattgttgatactttaggtgaaggagcttttggaaaagtcgtggagtgcattgat
cataaagcgggaggtagacatgtagcagtaaaaatagttaaaaatgtggatagatattgt
gaagctgctcgctcagaaatacaagttctggaacacttaaatactacagaccccagcagt
acattcggctgtgtccagatgttggagtggtttgagcatcatggtcacatttgcattgtg
tttgaactgctaggacttagtacctatgatttcattaaagaaaatggttttctgccattt
cgactggaccatattaggaagatggcatatcagatatgcaagtctgtgaattttctgcac
agtaataagttgactcacacagacttaaagcctgaaaacatcttatttgtgcaatctgat
tacacagaggcttataatcccaaaatgaaacgtgatgaacgtaccttaataaatccagat
attaaagttgtagattttggcagtgcaacatatgatgatgaacatcacagtaccttggtc
tctacaagacattatagggcacctgaagttattttagccctaggatggtcccaaccatgt
gatgtctggagtattggatgtattcttatagaatactaccttgggtttacagtatttcca
acacatgatagtaaggagcacttagcaatgatggaaaggattcttggacctttaccaaaa
catatgatacagaaaaccaggaaacgtaaatatttccatcatgaccgattggactgggat
gaacatagttctgctgggagatatgtttcaaggcgctgtaagcctctgaaggaatttatg
ctttctcaagatgctgaacatgagctgctctttgacctcattgagcaaatgttggaatat
gatccagctaaaaggattactctcaaagaagccttaaagcatcctttcttttaccctcta
aaaaaaactatatag

DBGET integrated database retrieval system