KEGG   Equus caballus (horse): 100068022Help
Entry
100068022         CDS       T01058                                 

Gene name
TESK1
Definition
testis-specific kinase 1
Orthology
K08841  
testis-specific kinase 1 [EC:2.7.12.1]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
25
AA seq 605 aa AA seqDB search
MDRVRPRAKASASISSFYRALRSAVSSLARVDDFHCAEKIGAGFFSEVYKVRHRQSGQVM
VLKMNRLPSNRGNTLREVQLMNRLRHPNILRFMGVCVHQGQLHALTEYMNGGTLEQLLSS
PEPLSWPVRLRLALDIARGLRYLHAKGVFHRDLTSKNCLIRREDRGFTAVVGDFGLAEKI
PVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLPR
TEDFGLDVPAFRSLVGDDCPLPFLLLAIHCCSMEPSTRAPFTEITQHLEWILEQLPEPAP
LPRAPLTHKQGSVPRGGPSATLPRPDPRLSRSRSDLFLPPSPESPPNWGDNLTRVNPFSL
REDLRGGKIKLLDTPSKLVAPLPLVPPSPLPSTQLPLVTTPETLVQPGTPARRCRSLPSS
PELPRRMETALPGPGPPAVGPSVEERMECEGSSPEPEPPGPAPQPPLATATDNFISTCSS
ASRPWSSRSGAPLNNNPPAVVVNSPQAWAGESWNRAQHSLPRAAALERTEPSPPPSAPRE
SDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPSLQL
PGARS
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggaccgggttcgcccccgggccaaggcatccgcatccatctcctccttctaccgggcc
ctccgcagcgccgtgtccagcctagcgcgcgtggacgatttccactgcgccgagaagatc
ggggccggcttcttctctgaggtctacaaggttcggcaccgacagtccgggcaagtcatg
gtgctgaaaatgaacaggctccccagtaatcggggaaatacgctacgggaggtgcagctg
atgaaccggctccggcaccccaacatcctaaggttcatgggggtctgtgtgcaccagggg
cagctgcacgctcttacagagtacatgaatggggggaccctggaacagctgctcagctcc
cccgaacccctatcctggcctgtcaggctccgcctggctctggacatcgcccgtggcctg
cggtacctgcatgccaaaggggtattccaccgagacctcacatccaagaactgtctgatc
cgacgggaagaccgaggcttcacagctgttgtgggtgacttcgggctggctgaaaagatt
cctgtgtatagggaaggggcgaggaaggagccgctggctgtggtgggttctccatactgg
atggcgccagaggtgttgcggggtgagctatatgatgagaaggctgatgtcttcgctttt
gggattgttctctgtgagctcatcgctcgagtacctgcggaccctgattacctaccccgt
actgaggactttggcctggatgtgcctgctttccggagcctagtaggggatgactgccca
ctgcctttcctgctcctggccatccattgctgcagtatggaacctagcactcgtgctccc
ttcactgaaatcacccagcacctggaatggatcctggagcagctccctgagccagccccc
ctccccagggctcccctgacacacaagcagggctctgttccaagagggggtccctctgcc
acgcttcccaggccagacccccggctctcccgcagccggtccgacctcttcctgcccccg
tcaccagaatcaccccccaactggggggacaatctgactcgagtcaatcccttctcacta
cgggaagacctcaggggtggcaagatcaagctcctggacacacccagcaagctagtcgca
cccctgccccttgtaccaccatcaccactgccctccacccagctgcccttggtgaccact
ccagagaccctggtccagcctgggacacctgcccgccgctgccgctcactaccgtcatcc
cctgagctcccccgacgtatggagacagcactgccaggtcctggccctcctgctgtgggc
ccctcagttgaagagagaatggagtgtgagggcagcagccctgagccggaacccccagga
ccagctccccagccgcccctggctacggccacagacaacttcatcagcacttgttcctca
gcctcccggccctggtcctctagatcaggagctccccttaacaacaaccccccagctgtg
gtggtgaactccccacaagcctgggctggggagtcctggaaccgggcccagcatagcctg
ccccgggcggcagccctggagcggacagaaccctcaccgcccccttcagctccccgggaa
tccgatgaggggctgccgtgcccaggctgctgccttggccccttcagctttggcttcctg
tccatgtgcccccgccccacaccagctgttgcccgctaccgcaacctgaactgtgaggcg
ggcagtctcctctgccaccgagggcaccatgccaagccacccacacccagcctgcagctg
cctggcgcacgctcttag

DBGET integrated database retrieval system