KEGG   Equus caballus (horse): 100068172Help
Entry
100068172         CDS       T01058                                 

Gene name
BDH2
Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase type 2
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00072  Synthesis and degradation of ketone bodies
ecb00650  Butanoate metabolism
ecb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100068172 (BDH2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    100068172 (BDH2)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     100068172 (BDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR ADH_zinc_N AlaDh_PNT_C DUF1776 UDPG_MGDP_dh_N 3HCDH_N NAD_binding_10 Sacchrp_dh_NADP DUF2325 HHH_5 UPF0146 FtsJ
Motif
Other DBs
NCBI-GeneID: 100068172
NCBI-ProteinID: XP_001499279
Ensembl: ENSECAG00000010010
UniProt: F7BDQ5
Position
3
AA seq 245 aa AA seqDB search
MGRLDGKVIVLTAAAQGIGRATAIAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVT
KKKQIDEFANEIERVDILFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMYLMIKAFLPKM
LAHKSGNIINMSSVASSIKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTV
DTPSLQERIQARPNPEEARSDFLKRQRTGRFATAEEIALLCVYLASDESAYVTGNPVIID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgacttgatgggaaggtcatcgtcctgacagctgctgctcaggggatcggccgg
gccactgccatagcttttgcaagagaaggtgccaaagtcatagccacagatatcaatgag
tccaaacttcaagaactggaaaagtacccgggtattcagactcgagtcctggatgtcaca
aaaaaaaaacaaattgatgagtttgccaatgaaattgagagagttgacattctctttaat
gttgctggttttgttcatcatggaaccatcctggactgtgaggagaaagactgggacttc
tcaatgaatcttaacgtccgcagcatgtacctgatgatcaaggcctttcttcctaaaatg
cttgctcacaaatctggcaatattatcaacatgtcctctgtggcttccagcatcaaagga
gttgtgaacagatgtgtctacagcacaaccaaggcggccgtgattggcctcacaaagtcc
gtggcagcagacttcatccagcaggggatcaggtgcaactgtgtgtgtccaggaaccgtt
gataccccatctctgcaagaaagaatacaagccagaccaaaccctgaagaggcacggagc
gacttcctgaagagacagaggacgggaagatttgcaaccgcagaagaaatagccctgctc
tgcgtgtacctggcttctgatgaatctgcctacgtcacaggtaatcctgtcatcattgat
ggaggctggagcttgtga

DBGET integrated database retrieval system