KEGG   Equus caballus (horse): 100068176Help
Entry
100068176         CDS       T01058                                 

Gene name
UGT2A1, UGT2A2
Definition
UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ecb  Equus caballus (horse)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100068176 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    100068176 (UGT2A1)
   00500 Starch and sucrose metabolism
    100068176 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100068176 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100068176 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    100068176 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100068176 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    100068176 (UGT2A1)
   00983 Drug metabolism - other enzymes
    100068176 (UGT2A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100068176 (UGT2A1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100068176 (UGT2A1)
Glycosyltransferases [BR:ecb01003]
 Others
  Hydrophobic molecule
   100068176 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 536 aa AA seqDB search
MVSIMDITMPKKFFQLLVFNLIVTEIVLSGNVLIWPTDGSHWLNIKIILEALIQRNHNVT
VLASSATLFIKSSSELPVNFEEIPVSYKKSNIDSLIEHMIMLWIDHRPTPLTLWTFYKEL
GKLLDTFFQINIQICDGILNNPKLMARLQKGGFDVLVSDPVTICGDLVALKLGIPFMYTL
RFSPASTVERHCGKNPAPASYVPAALSELTDQMTFGERVKNTISYSLQDYIFQSYWGEWN
SYYSKVLGRPTTLCEIMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEME
EFVQSSGEDGVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYAGKKPATLGANTRL
YDWMPQNDLLGHPKAKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAV
EVDINTMTSEDLLNALRTVTNDPSYKENAMRLSRIHHDQPMKPLDRAVFWIEFVMRHKGA
KHLRPAAHDLTWFQYHSLDVIGFLLVCAAAAIFLVAKCLLFSCRKLGKTGKKKKKE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggtttccataatggatatcaccatgcctaagaagtttttccagctgctggtttttaat
ttgattgtgactgaaattgttctaagtgggaatgtgttaatttggccaacagatggtagt
cattggttaaatattaagatcattttggaagcgttgattcaaagaaatcacaatgtgact
gtactggcttcatcagcaactctattcatcaaatccagttctgaacttcctgtgaatttt
gaggagatacctgtttcctacaagaagagcaatatagattccttaattgaacatatgata
atgctgtggatagaccatagaccaactcctctcacactctggaccttctacaaagaacta
ggaaaactcctagatactttttttcaaattaatatacaaatctgtgatggaatattaaac
aaccccaagttaatggcaagacttcagaaaggtggttttgatgtattggtctcagaccca
gtaacaatctgtggggacttggttgctctgaaattaggaattccatttatgtacacattg
aggttctctccagcctcaacagtggagagacactgtgggaaaaatccagcacctgcctcc
tatgtacctgcagctctgtcagagctcactgatcagatgacctttggtgaaagggtcaaa
aataccatatcttattctctgcaagattatatatttcaatcctactggggagaatggaat
tcgtactacagcaaagttctaggaagacccactacattatgtgagattatggggaaagca
gaaatttggctaatacggacatattgggattttgaatttcctcgtccatacttacctaat
tttgagtttgtaggaggattgcattgtaaacctgccaaaccgttacctaaggaaatggaa
gaatttgtccaaagttcaggtgaagatggtgttgtggtgttttctctggggtcaatggtt
aaaaatctcacagaagaaaaagccaatctcattgcctcagccctcgcccagattccacag
aaggttttatggaggtacgcaggaaagaaaccagccacattaggagccaatactcggctc
tatgactggatgccacagaatgatcttcttggtcatcccaaagcaaaagcttttatcact
catggtggaaccaatggtatctatgaagctatctatcatggggtccctatggtgggagtt
cctatgtttgctgatcagcctgataacattgctcacatgaaggccaaaggagcagctgtg
gaggtggacataaacacaatgacaagtgaagatttgctcaatgccttgagaacagtaact
aatgatccttcttataaagagaatgctatgagattatcaagaattcaccatgatcagcca
atgaagcctctagatcgagcagtcttctggatcgagtttgtcatgcgccacaaaggagcc
aaacacctgcggccagccgcccatgacctcacttggttccagtaccactctttggatgtg
attgggttcctgctggtctgtgcagcagctgctatattcctggtcgcaaaatgtcttttg
ttttcttgtcgaaaattaggtaaaacaggaaagaagaaaaagaaggaatag

DBGET integrated database retrieval system