KEGG   Equus caballus (horse): 100068301Help
Entry
100068301         CDS       T01058                                 

Gene name
PPT1
Definition
(RefSeq) palmitoyl-protein thioesterase 1
  KO
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ecb  Equus caballus (horse)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    100068301 (PPT1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100068301 (PPT1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100068301 (PPT1)
Lipid biosynthesis proteins [BR:ecb01004]
 Fatty acid synthase
  Component type
   100068301 (PPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
2
AA seq 306 aa AA seqDB search
MASPSWLRLLAVALLQASCAATALGRLDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEK
KIPGIYVLSLEIGKTVMEDVENSFFLNVNSQVTTVCQILAKDPKLQQGYNAMGFSQGGQF
LRAVAQRCPSPPMVSLITFGGQHQGIFGLPRCPGESSHICDLIRKTLNAGAYAKAIQERL
VQAEYWHDPIKEDVYRNHSVFLADINQERGVNESYKKNLMALKKFVMVKFLNDSIVDPVD
SEWFGFYRSGQAKETIPLQETTLYTQDRLGLKEMDKAGQLVFLAVEGDHLQLSEEWFYAH
IIPFLE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcccagctggttgcggctcctggccgtcgctctcctgcaggcgtcctgcgct
gccaccgcgctgggccgcctcgacccgccggcgccgctgccgctggtgatctggcatggg
atgggagatagctgttgtaatcccttaagcatgggtgctattaaaaagatggtcgagaag
aagatacctggaatttatgtcttgtctttagagattgggaagactgtgatggaggatgtg
gagaacagcttcttcttgaatgtcaattcccaagtaacaacagtgtgtcagattctcgct
aaggatcctaaattgcagcaaggctacaatgctatgggattctcccagggaggccagttt
ctgagggcagtggctcagagatgcccatcacctcccatggtcagtctgatcactttcggg
ggacagcatcaaggtatttttggactccctcgttgcccaggagagagctctcacatctgt
gacttgatcagaaaaacactgaatgctggggcttatgccaaagctattcaagagcgcctg
gtgcaagcagaatactggcatgaccccataaaggaggacgtctaccgcaaccacagcgtc
ttcttggcagatattaatcaggagagaggtgtcaacgagtcctataagaaaaacctgatg
gcactgaagaagtttgtgatggtgaaattcctcaatgattccattgtggaccccgtggat
tctgagtggtttggattttacagaagtggccaagccaaggaaaccattcccttacaggag
accacgctgtacacccaggaccgcctggggctaaaggaaatggacaaggcgggacagcta
gtgttcctggctgtagaaggggaccatcttcaactgtctgaggaatggttttatgcccac
atcatacccttcctggagtga

DBGET integrated database retrieval system