KEGG   Equus caballus (horse): 100068301Help
Entry
100068301         CDS       T01058                                 

Gene name
PPT1
Definition
palmitoyl-protein thioesterase 1
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ecb  Equus caballus (horse)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ecb01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ecb00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:ecb04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 317 aa AA seqDB search
MVAEPPRVEHSSRLRCNYESKEFIRGLPIPLPPLRDMHQLLNVDPQPRLLPFGDSCCNPL
SMGAIKKMVEKKIPGIYVLSLEIGKTVMEDVENSFFLNVNSQVTTVCQILAKDPKLQQGY
NAMGFSQGGQFLRAVAQRCPSPPMVSLITFGGQHQGIFGLPRCPGESSHICDLIRKTLNA
GAYAKAIQERLVQAEYWHDPIKEDVYRNHSVFLADINQERGVNESYKKNLMALKKFVMVK
FLNDSIVDPVDSEWFGFYRSGQAKETIPLQETTLYTQDRLGLKEMDKAGQLVFLAVEGDH
LQLSEEWFYAHIIPFLE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggtggctgagccacctcgtgtggagcattccagcaggctgagatgtaactatgaaagt
aaagagttcatcagaggccttcccattcccctgcctcctctcagagacatgcaccagctg
ctgaatgtggacccacaacctagattgctgcccttcggagatagctgttgtaatccctta
agcatgggtgctattaaaaagatggtcgagaagaagatacctggaatttatgtcttgtct
ttagagattgggaagactgtgatggaggatgtggagaacagcttcttcttgaatgtcaat
tcccaagtaacaacagtgtgtcagattctcgctaaggatcctaaattgcagcaaggctac
aatgctatgggattctcccagggaggccagtttctgagggcagtggctcagagatgccca
tcacctcccatggtcagtctgatcactttcgggggacagcatcaaggtatttttggactc
cctcgttgcccaggagagagctctcacatctgtgacttgatcagaaaaacactgaatgct
ggggcttatgccaaagctattcaagagcgcctggtgcaagcagaatactggcatgacccc
ataaaggaggacgtctaccgcaaccacagcgtcttcttggcagatattaatcaggagaga
ggtgtcaacgagtcctataagaaaaacctgatggcactgaagaagtttgtgatggtgaaa
ttcctcaatgattccattgtggaccccgtggattctgagtggtttggattttacagaagt
ggccaagccaaggaaaccattcccttacaggagaccacgctgtacacccaggaccgcctg
gggctaaaggaaatggacaaggcgggacagctagtgttcctggctgtagaaggggaccat
cttcaactgtctgaggaatggttttatgcccacatcatacccttcctggagtga

DBGET integrated database retrieval system