KEGG   Equus caballus (horse): 100068315Help
Entry
100068315         CDS       T01058                                 

Definition
cytochrome P450 2F5-like
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Metabolism of xenobiotics by cytochrome P450
Class
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:ecb00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 491 aa AA seqDB search
MDSINTPVLLLLLALVCLFLTLSSRSKGRLPPGPRPLPLLGNLLQLRSQNMLTSLTKLSK
KYGSVFTVHLGPRRVVVLSGYQTVKEALVDQAEEFSGRGDYPVFLNFTKGNGIAFSNGDR
WKVLRRFSIQILRNFGMGKRSIEERILEEGSFLLAELRNTDGEPFDPTFFLSRSVSNIIC
SVLFGSRFDYEDKRLLTIISLINENFQIMSSPWGELYNLFPSLLDWVPGPHRRLFQNFGC
VKDLIAHSVRDHQASLDPNSPRDFIDCFLTKMAQEKQDPLSHFNMDTLLMTTHNLLFGGT
ETVGTTLRFTFLVLMKYQEVQARIQEEIDRVVGRARLPALEDRTAMPYTDAVIHEVQRFA
DIIPMNLPHRVTQDTVFRGFLLPKGTDVITLLNTVHHDPTQFLTPREFNPEHFLDANRCF
TKSPAFMPFSAGRRQCLGESLARMELFLFLTAILQSFSLQPLGAPEDIDLTPLSSGLGNL
PRPFQLRLRAR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggacagtataaacacacccgtcttgctcctcctcctggctcttgtctgcctgttcctg
accctcagctcaaggagcaagggccggctgcctccaggccccaggcccctcccactcctc
ggaaacctgctgcagcttcgctcccaaaacatgctgacctcccttaccaagctgagcaag
aagtacggctcagtgttcacagtacacttgggccccagacgagtggttgtcctcagcggg
taccaaaccgtgaaggaggcccttgtggaccaggcggaggagttcagcggccgcggtgac
taccccgtctttctcaacttcactaagggcaatggcatcgccttctccaatggggaccgg
tggaaggtcctgaggagattctccatccagattctacggaacttcggaatggggaagagg
agcattgaggagcggatcctggaggaaggcagcttcctgctggcagagctccggaacact
gatggcgagcccttcgaccccacgtttttcctgagccgctccgtgtccaacatcatctgc
tccgtgctcttcggcagtcgcttcgactacgaggacaaacgtctgctcaccattataagc
ctcatcaatgaaaacttccaaatcatgagcagcccctggggcgagttgtacaacctcttt
ccaagcctcctggattgggtgcccgggccgcacagacgccttttccagaacttcgggtgc
gtgaaggacctcatcgcccacagcgtgcgcgatcaccaggcctcccttgaccccaactct
cctcgggacttcattgattgcttcctcaccaagatggcacaggagaagcaggaccccctg
agccacttcaacatggataccctgctgatgaccacacataacctgctgtttggcggcacc
gagaccgtgggcaccacgctgcgcttcactttcctcgtgcttatgaagtaccaagaagtg
caagcccgcatacaggaggagatcgacagagtggtgggacgcgcgcggctgccagcgctg
gaggaccgaacggccatgccttatacagatgcagtgatccacgaggtgcagcgcttcgca
gacatcatccccatgaacttgccgcaccgcgtcactcaggacacggtctttcgcggcttc
ctgctgcccaagggcacggatgtcatcaccctccttaacaccgtccatcacgaccccacc
cagttcctgacgccccgggagttcaaccctgaacactttctggatgccaatcggtgcttc
acgaagagccctgccttcatgcccttctctgctggacgccgacagtgcctgggcgagtct
ctggcgcgcatggagctcttcctctttctcaccgccatcctgcagagcttctcgctgcag
ccgctgggggcgcccgaggacatcgacctgacgccgctcagctctggtctcggcaatttg
ccgcggccgttccagctgcgcctgcgcgcgcgctga

DBGET integrated database retrieval system