KEGG   Equus caballus (horse): 100068315Help
Entry
100068315         CDS       T01058                                 

Definition
(RefSeq) cytochrome P450 2F5
  KO
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100068315
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100068315
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP2 family
   100068315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 504 aa AA seqDB search
MLSRQETPAAAFTMDSINTPVLLLLLALVCLFLTLSSRSKGRLPPGPRPLPLLGNLLQLR
SQNMLTSLTKLSKKYGSVFTVHLGPRRVVVLSGYQTVKEALVDQAEEFSGRGDYPVFLNF
TKGNGIAFSNGDRWKVLRRFSIQILRNFGMGKRSIEERILEEGSFLLAELRNTDGEPFDP
TFFLSRSVSNIICSVLFGSRFDYEDKRLLTIISLINENFQIMSSPWGELYNLFPSLLDWV
PGPHRRLFQNFGCVKDLIAHSVRDHQASLDPNSPRDFIDCFLTKMAQEKQDPLSHFNMDT
LLMTTHNLLFGGTETVGTTLRFTFLVLMKYQEVQARIQEEIDRVVGRARLPALEDRTAMP
YTDAVIHEVQRFADIIPMNLPHRVTQDTVFRGFLLPKGTDVITLLNTVHHDPTQFLTPRE
FNPEHFLDANRCFTKSPAFMPFSAGRRQCLGESLARMELFLFLTAILQSFSLQPLGAPED
IDLTPLSSGLGNLPRPFQLRLRAR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctctcaagacaggagacacctgcagctgccttcaccatggacagtataaacacaccc
gtcttgctcctcctcctggctcttgtctgcctgttcctgaccctcagctcaaggagcaag
ggccggctgcctccaggccccaggcccctcccactcctcggaaacctgctgcagcttcgc
tcccaaaacatgctgacctcccttaccaagctgagcaagaagtacggctcagtgttcaca
gtacacttgggccccagacgagtggttgtcctcagcgggtaccaaaccgtgaaggaggcc
cttgtggaccaggcggaggagttcagcggccgcggtgactaccccgtctttctcaacttc
actaagggcaatggcatcgccttctccaatggggaccggtggaaggtcctgaggagattc
tccatccagattctacggaacttcggaatggggaagaggagcattgaggagcggatcctg
gaggaaggcagcttcctgctggcagagctccggaacactgatggcgagcccttcgacccc
acgtttttcctgagccgctccgtgtccaacatcatctgctccgtgctcttcggcagtcgc
ttcgactacgaggacaaacgtctgctcaccattataagcctcatcaatgaaaacttccaa
atcatgagcagcccctggggcgagttgtacaacctctttccaagcctcctggattgggtg
cccgggccgcacagacgccttttccagaacttcgggtgcgtgaaggacctcatcgcccac
agcgtgcgcgatcaccaggcctcccttgaccccaactctcctcgggacttcattgattgc
ttcctcaccaagatggcacaggagaagcaggaccccctgagccacttcaacatggatacc
ctgctgatgaccacacataacctgctgtttggcggcaccgagaccgtgggcaccacgctg
cgcttcactttcctcgtgcttatgaagtaccaagaagtgcaagcccgcatacaggaggag
atcgacagagtggtgggacgcgcgcggctgccagcgctggaggaccgaacggccatgcct
tatacagatgcagtgatccacgaggtgcagcgcttcgcagacatcatccccatgaacttg
ccgcaccgcgtcactcaggacacggtctttcgcggcttcctgctgcccaagggcacggat
gtcatcaccctccttaacaccgtccatcacgaccccacccagttcctgacgccccgggag
ttcaaccctgaacactttctggatgccaatcggtgcttcacgaagagccctgccttcatg
cccttctctgctggacgccgacagtgcctgggcgagtctctggcgcgcatggagctcttc
ctctttctcaccgccatcctgcagagcttctcgctgcagccgctgggggcgcccgaggac
atcgacctgacgccgctcagctctggtctcggcaatttgccgcggccgttccagctgcgc
ctgcgcgcgcgctga

DBGET integrated database retrieval system