KEGG   Equus caballus (horse): 100068506Help
Entry
100068506         CDS       T01058                                 

Gene name
DOT1L
Definition
(RefSeq) DOT1 like histone lysine methyltransferase
  KO
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
ecb  Equus caballus (horse)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100068506 (DOT1L)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100068506 (DOT1L)
Enzymes [BR:ecb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100068506 (DOT1L)
Chromosome [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100068506 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 1650 aa AA seqDB search
MVLGGSGLVSPTRLQSTHRPAGLPRLRAGLGLQEPLPGWLPRTAAGGRPLATGPLQRTAP
RESGSGGRSAGSSDSLPSASPWLLFSCVLCCVSLIVSSVDLATQPGVFCAFAGPVGAGAE
TVCLGLSKRCRPATEWDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESM
QRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSNGLLRHLLQQVYNHSVTDPEKLNNYEPF
SPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIP
AKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDH
QLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVS
YYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRDAKSNTTTPTKVPEGKAAAPVDTP
MDSGAEDEKAGATAVKKPSPSKARKKKLNKKGRKMAGRKRGRPKKASTANPERKPKKTQT
ALDLLHAQTVSQAASPSPQDAYKSPHSPFYQLPPSVQRHPPDQLLLAPTPPALQKLLESF
KIQYLQFLAYTKTPQYKANLQQLLDQEKEKNARLLGAAQQLFGHCQAQKEEIKRLFQQKL
DELGVKALTYNDLIQAQKEISAHNQQLREQTEQLEKDNQELRSQSLQLLKARCEELKLDW
STLSLESLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLKSCVPPDDGLPL
PLRGKGALGRELEAEPGRLPLELDCSKLSLPHFSSMSPELSMNGHAAGYELCSALSRPSS
KQNTPQYLASPLDQEVVPCTPSHGSRPRLEKLSGLALPDYTRLSPAKLVLRRHLSQDHAV
SSKAAAGELHPRAEHAKENGLPYQSPVIANGIKLSPQDPRPSSPVALQMTGEKGSEKGLK
ERTYASSGEAITSLPVSIPLSTVQPSKLPVSIPLASVVLPSRAEKARSTPSPVPQPRDSS
STLEKQPGAGAHGAASSAAGGRGLALAPAGFSYAGSVAISGALAGSPAPLAPGVEPTAFD
ESSSSGSLFATMGSRSSTPQQPPLLVQPRNSGSASPAHQLCASPRLSAAQGPPPDAGKVD
LPCESGLSDPESEARRRVVFTISAGAPGSKQSPSSKHSPLPSGARGDSGQSHGQDSRKRG
RRKRASVGTPSLSSGVSPKRRALPSVAGLFTQSSGSPLNLNSMVNNINQPLEITAISSPE
SSLKSSPVPYQDNDQPPVLKKEKPLSQTNGAHYSPLTSDEEQGSEDEPGSARIERKIATI
SLESKSPPKTLENGGGLAGRKPTPAGEPVNSSKWKSTFSPISDLGLAKAADSPLQASSTL
SQNSLFAFRPGLDEPGSADAKLAAHPRKSFPGALAGAGGLSPSSTPPNGFAFSGGLAADL
SAHSFSDGAALSHKAPEVAGLGAAPSFPAPRGKEAGAAEPGSFVNKRQLDGLGGPKGEGG
KGRDVGELGLPVVGPSDRALLVHSKVGKGRDREPDSKNGHNLFISAATVPPGGLLSGPGL
ATAASSAGSATPSAQTHRPFLGSFTPGPQFALGPMSLQANLGSSVLQSLFSSVPAAAGLV
HVSSAATRLTNSHAMGSFSSGVAGGAVGGN
NT seq 4953 nt NT seq  +upstreamnt  +downstreamnt
atggttctgggtggttctggcttggtgtctcctacgaggttgcagtcaacacacaggccg
gccgggctgcctcgtctgagggctggactggggctgcaggagccgcttccaggatggctc
cctcgcacggctgctggcgggaggcccctcgccacggggcctctccagaggactgctcct
agagagagtggttcaggagggagaagcgctgggagttcagactcactgccctcagcatcc
ccgtggctgcttttctcctgtgtgctttgctgtgtgagtctgatcgtctcttccgtggac
cttgcgacacagcctggcgtcttctgtgcttttgcagggccagtgggtgccggagccgag
accgtatgtctgggtctcagtaaacgttgtcgaccagcaacagagtgggacaagcaccac
gatgctgctcacgagatcatcgagaccatccgatgggtgtgtgaagaaatcccagatctc
aagcttgccatggagaactatgttttaatcgactacgacaccaaaagctttgaaagcatg
cagaggctctgtgacaagtacaaccgggccatcgacagcatccaccagctgtggaagggg
accacgcagcccatgaagctgaacacgcggccgtccaacgggctcctgcgtcacctgctg
cagcaggtgtacaaccactcggtgactgaccccgagaagctcaacaactacgagcccttc
tccccggaggtgtacggcgagacctccttcgacctggtggcgcagatgatcgatgagatc
aagatgactgaggacgacctattcgtggacctgggcagcggagtgggccaggtcgtactg
caggtcgccgctgccaccaactgcaaacatcattatggcgtcgagaaagctgacatccca
gccaagtacgcagagaccatggaccgagagttcaggaagtggatgaaatggtatggaaaa
aagcatgcagaatacacactggaaagaggcgatttcctctcggaagagtggagagagcgg
attgccaacacaagtgttatatttgtgaataactttgcctttggtcctgaggtggatcac
cagctgaaggagcgatttgcaaacatgaaggaaggtggcagaattgtgtcctcgaagccc
tttgcacctctgaacttcagaataaacagtagaaacttgagtgacatcggcaccatcatg
cgcgttgtggagctctcgccactgaagggctcggtgtcgtggacggggaagccggtctcc
tactacctgcacaccatcgaccgcaccatacttgaaaactatttttctagtctgaaaaac
ccaaaactcagggaggagcaagaggcagcccggcgccggcagcagcgggacgccaagagc
aacacgaccactcccaccaaggtgcccgagggcaaggcggccgcgcctgtggacaccccc
atggattctggtgctgaggacgagaaagctggggcgaccgccgtcaaaaagccgtccccg
tccaaagcgcggaagaagaagctgaacaagaagggccggaagatggccggccggaagcgc
gggcgtcccaagaaggcgagcactgcgaaccccgagcgtaagcccaagaagacccaaact
gcactggacctcctgcacgcgcagaccgtgtctcaggcggcgtcgccctcgccgcaggat
gcgtacaagtcacctcacagcccgttctaccagctacctcccagcgtgcagcggcacccc
cccgaccagctgctgctggcccccaccccgcccgcactgcagaagctgctagagtccttc
aagattcagtacttgcagttcttggcgtacacgaagacccctcagtacaaggccaacctg
cagcagctgctggaccaggagaaggagaagaacgctcgcttgctgggcgccgcgcagcag
ctgttcggccactgccaggcccagaaggaggagatcaagaggctcttccagcagaagctg
gatgagctgggagtgaaggcgctgacctacaatgacctgatccaagcgcagaaggagatc
tcggctcacaaccagcagctgagggagcagacggagcagctggagaaggacaaccaggag
ctgcggagccagagcctgcagctgctcaaggctcggtgtgaggagctgaagctggactgg
tccacgctgtccctggagagcctgctgaaggagaagcaggccctgaagagccagatctcc
gagaagcagcggcactgcctggagctgcagatcagcatcgtggagctggagaagagccag
cggcagcaggagctcctgcagctcaagtcctgcgtgccgcccgacgatggcctgcccctg
cccctgcgcgggaagggcgcgctgggccgggagctggaggcggagcccggccggctgccc
ctggagctggactgctccaagctctccctgccccacttcagcagcatgagcccggagctc
tccatgaacggccacgcggccggctacgagctctgcagcgcgctgagccggccctcgtcc
aagcagaacaccccccagtacctggcctccccgctggaccaggaggtcgtgccctgcacc
cccagccacggcagccggccgaggctcgagaagctgtccgggctggccttgcctgactac
acccggctctcgccggccaagctggtgctgaggcgccacctgagccaggaccacgcggtc
agcagcaaggcagccgctggcgagctgcacccgagagctgagcacgccaaggagaacggc
cttccctaccagagccctgtcatcgccaacgggatcaagctgagccctcaggaccctcgg
ccctcgtcccccgtggccttacagatgacgggagagaagggcagcgagaagggcctgaag
gagcgcacctacgccagcagcggggaggccatcaccagcctgcccgtgagcatcccgctc
agcaccgtgcagcccagcaagctgcctgtcagcatccccctggccagcgtggtgctgccc
agccgcgccgagaaggcgagaagcacccccagccctgtgccgcagccccgagactcctca
tccacactggagaagcagccgggtgccggtgcccatggtgccgcgagcagcgctgctgga
ggcagaggcctcgccctggcacctgcgggattctcctatgctggctccgtggccatcagt
ggggccctggcgggcagcccggccccactcgctcctggagtcgagcccaccgcctttgat
gagtcctccagctcggggagcctcttcgccaccatggggtcccgcagctccaccccgcag
cagccccccctgcttgtgcagccgcggaactccggctcggcctcgcccgcccaccagctc
tgcgccagtccacggctcagcgccgcccagggtccgccccccgatgccggcaaggtggac
cttccgtgcgagtccggcctctccgacccggagagcgaggccaggaggagggtcgtcttc
accatctcggcaggtgcccccggctccaagcagtcgccttccagcaagcacagccccctg
ccctcgggtgcccgtggggacagcggccagagccacgggcaggacagccgcaagcggggc
aggaggaagcgggcgtcggtggggacccccagcctcagctcgggtgtgtcccccaagcgc
cgggccctgccatccgtcgccggcctcttcacgcagtcttcagggtcccccctgaacctc
aactccatggtcaacaacatcaaccagcctctggaaatcacggccatctcgtctccagag
agctccctgaagagctccccggtcccttaccaggacaatgaccagccgcccgtgctcaag
aaggagaagcccctgagccagaccaatggggcccactattccccgctgacctcggacgag
gagcagggctccgaggacgagcccggcagcgccagaattgagagaaaaattgcaactatc
tccttagaaagcaaatctcctccaaaaaccttggaaaacggtggcggcctggcggggagg
aagccgacgcccgccggcgagcccgtcaacagcagcaagtggaagtccaccttctccccg
atctccgacctcggcctggccaaggccgccgacagcccgctgcaggccagctccactctg
agccagaactccctgttcgctttccggcccggcctggacgagcccggctcggctgacgcc
aagctggccgcccaccccaggaagagctttcccggcgccctggcaggggctggcgggctg
agcccgagcagcacccctcccaacggcttcgccttcagcgggggcctggctgctgacctc
agtgcacacagcttcagtgatggcgctgctctctcccacaaggcccctgaggtggccggc
ctgggtgccgccccgagctttcccgcgccgaggggcaaggaggccggtgccgcggagcct
ggctcatttgtgaacaagaggcagctggatggactgggtggcccgaagggcgaggggggc
aagggcagggatgtgggcgagctgggcctgcccgtggtcgggccctcggacagggccttg
ctggtgcacagcaaggtgggcaagggccgcgaccgcgagcccgactccaagaatggccac
aatctcttcatttctgctgccactgtgcctcccgggggcctcctcagtggaccaggcctc
gccacagcggcatcctcggcgggcagcgcaacgccctctgcccagacgcaccgccccttc
ctgggctccttcacccccggcccgcagtttgccctgggccccatgtccctgcaggccaac
ctgggctcgtctgtgctgcagtccttgttcagctccgtgccggccgccgccggcctggtg
cacgtctcgtccgccgcaaccagactgaccaactcgcacgccatgggcagcttctcctcc
ggggtagcaggcggcgcagttggaggtaactag

DBGET integrated database retrieval system