KEGG   Equus caballus (horse): 100068569Help
Entry
100068569         CDS       T01058                                 

Definition
cytochrome P450 2B4-like
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ecb00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ecb00590]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:ecb00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:ecb05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 518 aa AA seqDB search
MALMAILLLIILIGLLLLWSQPTSRGRLPPGPWPLPFLGNILHLDHKDFLKSFQALREKY
GDVFTIYLGTQPAVILCGYEAVREALVDQAEAFSGRGHVAILDPILQGAGVAFANGKSWK
TLRRFSVATMKDFGMGKRSMEERIKEESQCLVEELRKSQGSYLDPTVLFNSVTANILCSI
IFGERFNYQDTQFLRLLNLMNEVLIILSSFYSQVFEFLSSILKHFPGPHTRLYRIIQEME
NFTSENIKRHWKTLDPSNPRDLIDSFLLRMDKECSDPETDFHHKNLIHTVLSLLFAGTET
SSSTLRYALLLLFKYPDVLEKVQAEIDRVIGPHRLPALEDQAKMPYTDAVIHEIQRFIDL
IPFGVPHLVIKDTDFRGYHLPKDTTVYVMLTSVLHDPRHFEKPDVFYPGHFLDAEGNFRK
HEAFIPFSMGKRLCLGEGLARSQLFLILTSMLQNFSLGSPQAPEDIDFTPRINGLTKLPS
VFQLSFLPRQGGGQGMQTPSESLHPAPTSAHNEFVEVS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgatggccatcctgcttctcatcatcctcattggcctcttgctactctggagc
cagcccacttcccggggtcgcctccctcctggaccttggcctctgcccttcctgggaaac
attttgcatctggaccacaaggactttctcaagtccttccaggcgctgcgagagaaatac
ggggatgtcttcacgatctacctggggacccagccagccgtcatcctgtgtgggtacgag
gcagtgagagaggccctggtggatcaggctgaggctttttctggccgaggtcacgttgcc
atcctcgaccccatcttgcagggagctggtgttgcctttgccaatggaaagtcttggaag
acccttcgacgattctctgtggccaccatgaaggactttggcatggggaaacggagcatg
gaggaacgaatcaaggaggagtctcagtgtctggtggaggagctgcggaaatcccaaggg
tcctatctggatcccaccgtcctctttaactctgttacggccaacatcctctgctccatt
atatttggtgagcgctttaattaccaggacacccaattcttacggctgctaaatttaatg
aatgaagtcctcatcatcctcagctctttctacagccaggtgtttgaattcctctctagc
atcttgaaacactttcctggcccacacactcgcttgtacagaatcattcaagaaatggaa
aattttacctctgagaacatcaagaggcactggaaaacgctggaccccagcaacccaagg
gacctcattgattccttcctgctccgcatggacaaggaatgctcagatcctgagactgac
ttccaccacaagaatctcatccacaccgtgctctcgttgctcttcgctggcacggagacc
tccagctccacactccgctatgcgcttcttctcctttttaagtacccggatgtcttagag
aaagtccaggcagagattgacagagtgattggcccacatcgtctcccagcccttgaagat
caggcaaaaatgccttatacagatgctgtgatccatgagatacaaagattcattgacctc
atcccctttggtgtcccccaccttgtcatcaaggacactgacttccggggatatcatctc
cctaaggacactactgtgtatgtcatgctgacctctgtcctccatgacccacgccacttt
gagaagccagatgtcttctaccctggtcactttctggatgcagagggcaacttcagaaag
cacgaagccttcattcctttctccatgggaaaacgtctctgtctgggtgagggcttggct
cgctcccagctcttcctcatcttgacctcgatgctgcagaacttctccttgggctctcct
caggccccagaagacattgacttcacacccaggataaatgggttgacaaagctgccctct
gtgttccagctgtccttccttccccgccagggagggggacaagggatgcagaccccctca
gaatctttgcatccagcccccacctctgcccacaatgaatttgtggaggtctcctga

DBGET integrated database retrieval system