KEGG   Equus caballus (horse): 100068840Help
Entry
100068840         CDS       T01058                                 

Gene name
GAMT
Definition
guanidinoacetate N-methyltransferase
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
ecb  Equus caballus (horse)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ecb00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ecb00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 184 aa AA seqDB search
MPAPFVCPGGRVLEVGFGMAIAASKVQEAPIEEHWIIECNDGVFRRLQDWAPRQPHKVVP
LKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIRAHAFRLLKPGGVLTYCNLT
SWGELLRSKYSDITAMFEETQVPALLEAGFLRENIRTEVMELVPPAECRYYSFPRMLTPW
VTKH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgccctttgtctgcccagggggccgcgtcctggaggtgggcttcggcatggcc
atcgcggcctccaaggtgcaggaggcccccatcgaggagcactggatcatcgagtgcaat
gacggcgtcttccggcggctccaggactgggcgcctcggcagccgcacaaggtggttccc
ttgaaaggcctgtgggaggaggtggcgcccaccctgccagacggtcactttgacgggatc
ctgtacgacacgtacccgctgtcggaggagacctggcacacgcaccagttcaacttcatc
agggcccacgcctttcgtctgctgaagccggggggcgtcctcacctactgcaacctcacc
tcctggggggagctgctgaggtccaagtactcggacatcaccgccatgttcgaggagaca
caggtgccggccctgctggaggcgggcttcctgcgtgagaacatccgcacagaggtgatg
gagctggtcccgccggctgagtgtcgctactacagcttcccgcgcatgctcacgccctgg
gtcaccaagcactga

DBGET integrated database retrieval system