KEGG   Equus caballus (horse): 100068840Help
Entry
100068840         CDS       T01058                                 

Gene name
GAMT
Definition
guanidinoacetate N-methyltransferase
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
ecb  Equus caballus (horse)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100068840 (GAMT)
   00330 Arginine and proline metabolism
    100068840 (GAMT)
Enzymes [BR:ecb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     100068840 (GAMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 184 aa AA seqDB search
MPAPFVCPGGRVLEVGFGMAIAASKVQEAPIEEHWIIECNDGVFRRLQDWAPRQPHKVVP
LKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIRAHAFRLLKPGGVLTYCNLT
SWGELLRSKYSDITAMFEETQVPALLEAGFLRENIRTEVMELVPPAECRYYSFPRMLTPW
VTKH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgccctttgtctgcccagggggccgcgtcctggaggtgggcttcggcatggcc
atcgcggcctccaaggtgcaggaggcccccatcgaggagcactggatcatcgagtgcaat
gacggcgtcttccggcggctccaggactgggcgcctcggcagccgcacaaggtggttccc
ttgaaaggcctgtgggaggaggtggcgcccaccctgccagacggtcactttgacgggatc
ctgtacgacacgtacccgctgtcggaggagacctggcacacgcaccagttcaacttcatc
agggcccacgcctttcgtctgctgaagccggggggcgtcctcacctactgcaacctcacc
tcctggggggagctgctgaggtccaagtactcggacatcaccgccatgttcgaggagaca
caggtgccggccctgctggaggcgggcttcctgcgtgagaacatccgcacagaggtgatg
gagctggtcccgccggctgagtgtcgctactacagcttcccgcgcatgctcacgccctgg
gtcaccaagcactga

DBGET integrated database retrieval system