KEGG   Equus caballus (horse): 100068875Help
Entry
100068875         CDS       T01058                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100068875
Peptidases [BR:ecb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100068875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 312 aa AA seqDB search
MPRKGIITSRSPDNSLVRGDITGSPQAGTQHLPNHGTATFCWLLSCCALLGTAVGCQVPM
THPLLTGLSRIINGEDAVPASWPWQVSLRADLPVCLQDSTGFHFCWGSLISENWVVTAAH
CSITXRTSDMIVARVFDQGSDAEDPQVLKIAQVFKNPKFNRFTLNIAITLLKLAASAMCL
PTEADNFPAGXAATIGWGKTSRPGTHTLDRLQRAALSLLSTNAECRKFWGSTVIDLMVCA
GARGASSFICDSGGPLFCQKDGVSTLVGIVSWSSSTCSTSSPSVYTRITKLMXWVRQVLE
AIGAPGPPSPPG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggaaagggattatcacttcaaggtctccagataacagcctggtgcgtggggat
ataacagggagcccccaggcaggcacccagcacctccccaaccatggcaccgccaccttc
tgctggctcctctcctgctgtgccctcctgggcacagctgttggctgccaggtccccatg
acccaccccctgctgactggcctgtccaggatcatcaatggggaagacgctgtccctgcc
tcctggccctggcaggtgtccctgcgcgctgacctccccgtctgcctccaggacagcacc
ggcttccacttctgctggggctccctcatcagcgagaactgggtggtcaccgctgcccac
tgcagcatcacatgaagaacctccgacatgatcgtggccagggtgtttgaccagggctca
gacgccgaggacccccaggtgctgaagattgcccaggttttcaagaaccccaagttcaac
aggttcaccctcaacattgccatcaccctgctgaagctggctgcgtccgccatgtgcctg
cccaccgaggccgacaacttccctgctgggnatgctgccaccataggctggggcaagacc
agccgccccggtacccacacccttgacaggctgcagcgggcggccctgtccctcctgtcc
accaacgcggagtgcaggaagttctggggcagcaccgtcatcgacctcatggtctgtgcc
ggggcgaggggcgcctcctccttcatatgtgactctggaggtcccctgttctgccagaag
gatggagtctcgactctggtgggcatcgtgtcctggagcagcagcacctgctccacctcc
agccccagcgtgtacacccgcatcaccaagctcatgncctgggtgcggcaggtcctggag
gccatcggagccccaggcccaccctcgcctcctggctga

DBGET integrated database retrieval system