KEGG   Equus caballus (horse): 100069005Help
Entry
100069005         CDS       T01058                                 

Gene name
MMP8
Definition
matrix metallopeptidase 8 (neutrophil collagenase)
Orthology
K01402  
matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.34  neutrophil collagenase
     100069005 (MMP8)
Peptidases [BR:ecb01002]
 Metallo Peptidases
  Family M10
   100069005 (MMP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 503 aa AA seqDB search
MMQRTSGHPPGQGPYSKGPRGRPGEAVFEEKAMFSLKTLPLLLLLPIQLSKAFPVPPESP
EEKKAKIVQNYLENFYQLPRKGYQAARKNSTSMVVEKLKEMQRFFGLNVTGKPNEETLEM
MQKPRCGVPDTGEFMITPGNPKWERNNLTYRIINYTPHLLLRADVERAFERAFEEWSIAS
SLKFKKISQGEADIRIAFYQGDHGDNSPFDGPNGILAHAFQPGPGIGGDAHFDAEETWTD
NRTNYNLLIVAAHEFGHSLGLAHSTNPAALMYPTYAFRDPSTYLLSQDDINGIQAIYGPS
NDPIQPTGSTAPTACDPRLTFDAIVTLRGETLFFKNEYFWRRHPQLPTVELNFISLFWPS
LPNGIQAAYEDFDRDLIFLFKGNQYWALNGYDIQQGYPKDISNYGFPSSVQAIDAAVSYR
SKTYFFVNDQFWRYDNQRRSMEAGYPQSIASTFPGIGSRIDAVFQQDDFFLFFSGPVYYA
FDLNTQRVTRVARINKWLNCRRS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcgaacctcagggcacccaccagggcaaggtccctactcaaaggggccaaga
ggaaggccaggagaggcagtgtttgaggaaaaggccatgttcagtctgaagacgcttcca
ctcctgctcctactccccatacagctttccaaggcctttccagtacctcctgaatcccca
gaagagaagaaggcaaaaattgttcagaattaccttgaaaatttctaccaattaccaagg
aaaggatatcaggctgcaaggaagaacagcactagcatggttgttgaaaagcttaaagaa
atgcaacgattctttgggttgaatgtgacagggaagccaaatgaggaaactctggaaatg
atgcagaaacctcgctgtggagtgcctgacactggagagtttatgataaccccagggaac
cccaagtgggaacgaaataacctgacctacaggattattaactataccccacacttgctg
ctaagggctgatgttgaaagagcttttgagcgtgcctttgaagagtggagtatagcatca
tccctgaagttcaagaagatctcacagggagaagcagacatcaggattgctttttaccaa
ggagatcatggtgacaattctccatttgatggacccaatggaatccttgctcatgccttt
cagccaggcccaggtattggaggagatgctcattttgatgcagaagaaacatggaccgac
aacagaacaaattacaacttgcttattgttgctgcccatgaatttggccattccttgggg
ctcgctcactccacaaaccctgctgccttgatgtatcccacctacgctttcagggacccc
agcacctacttgctctctcaggatgacatcaatggcattcaggccatctatggaccttca
aatgaccctatccaaccaactggatcaaccgcgcccaccgcctgtgaccccagactgaca
tttgatgctatcgtcacactccgcggagaaacgcttttctttaaaaacgagtacttttgg
agaaggcatccccaactgccaacagtcgaactcaatttcatttctctgttctggccatcc
ttgccaaatggtatacaggcggcttatgaggattttgacagggacctaattttcctattt
aaaggcaaccaatactgggctctgaatggctatgacattcagcaaggttatcccaaggac
atatcaaactacggcttcccaagcagtgtccaagcaattgatgcagctgtttcctatagg
agtaaaacatacttctttgtaaatgatcaattctggagatatgataaccaaagacgatcc
atggaagcaggttatccccaaagcatagcaagtacctttccaggaataggaagcagaatt
gatgcagttttccagcaagatgacttctttcttttcttcagcggaccagtttattatgca
tttgatcttaatactcagagagttactagggttgcaagaatcaataaatggcttaactgt
agacgaagttga

DBGET integrated database retrieval system