KEGG   Equus caballus (horse): 100069096Help
Entry
100069096         CDS       T01058                                 

Gene name
RXRA
Definition
retinoid X receptor, alpha
Orthology
K08524  
retinoid X receptor alpha
Organism
ecb  Equus caballus (horse)
Pathway
PPAR signaling pathway
PI3K-Akt signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bile secretion
Hepatitis C
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ecb04151]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:ecb04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:ecb03320]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:ecb04919]
Organismal Systems; Digestive system; Bile secretion [PATH:ecb04976]
Human Diseases; Cancers; Pathways in cancer [PATH:ecb05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:ecb05202]
Human Diseases; Cancers; Thyroid cancer [PATH:ecb05216]
Human Diseases; Cancers; Small cell lung cancer [PATH:ecb05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:ecb05223]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:ecb04932]
Human Diseases; Infectious diseases; Hepatitis C [PATH:ecb05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
25
AA seq 494 aa AA seqDB search
MNETPRSPPPPAHPCSLGCNLAIRWTVRTWCGCKDLDFSSQVNSSSLSSPTGRGSMAAPS
LHPSLGPGMGSSLGSPGQLHSPISSLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFG
TGSPQLNSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYG
VYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEE
RQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTEAYVEANVGLNPSSPNDPVTNI
CQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLAT
GLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAE
VEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPID
TFLMEMLEAPHQMT
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaccccacggtcacccccccctcctgcccacccctgcagcctggggtgcaat
ttggccatccggtggactgtcagaacctggtgcggctgcaaggaccttgacttctccagc
caggtgaactcctcgtccctcagctctcccacgggccgtggctccatggccgccccctcg
ctgcacccctccctagggcctggcatgggctcctcgctcggctcccccggacagctgcac
tcgcccatcagctccttgagctcgcccatcaacggcatgggcccgcccttctccgtcatc
agctcccccatgggcccccactccatgtccgtgcccaccacacctaccctgggcttcggc
actggcagcccccagctcaactcgcccatgaaccccgtcagcagcagcgaggacatcaag
cccccgctgggcctgaacggcgtcctcaaggtcccggcccacccctcagggaacatggca
tccttcaccaagcacatctgtgccatctgcggggaccgctcctcaggcaagcactacggg
gtgtacagctgcgagggctgcaagggcttcttcaagcggacggtgcgcaaggacctgacc
tacacctgccgggacaacaaggactgtctgatcgacaagcggcagcgcaaccgctgccag
tactgccgctaccagaagtgcctggccatgggcatgaagcgggaagccgtgcaggaggag
cggcagcggggcaaggacaggaatgagaatgaggtggagtccacgagcagcgcaaacgag
gacatgccggtggagaagatcctagaggctgagctggctgtggagcccaagactgaggca
tacgtggaggcgaacgtggggctgaaccccagctcgcccaacgaccctgtcaccaacatc
tgccaggcagcggacaagcagctcttcaccctggtggagtgggccaagcggatcccgcac
ttctccgagctgcccctggacgaccaggtcatcctgctgcgggcaggctggaacgagctg
ctcatcgcctccttctcccaccggtccatagctgtgaaggacgggatcctgctcgccacc
gggctgcacgtgcaccggaacagcgcccacagcgcgggggtgggcgccatcttcgacagg
gtgctgacggagcttgtgtccaagatgcgcgacatgcagatggacaagacggagctgggc
tgcctgcgtgccatcgtcctcttcaacccggactccaaggggctctcgaacccggccgag
gtggaggccctgcgggagaaggtctacgcgtccctggaggcctactgcaaacacaagtac
cccgagcagccgggaaggttcgccaagctgctgctgcgcctgcctgccctgcgctccatc
ggcctcaagtgcctggaacatctcttcttcttcaagctcattggggacacgcccatcgac
accttcctcatggagatgctggaagccccgcaccaaatgacttag

DBGET integrated database retrieval system