KEGG   Equus caballus (horse): 100069148Help
Entry
100069148         CDS       T01058                                 

Gene name
CHP2
Definition
calcineurin-like EF-hand protein 2
Orthology
K17611  
calcineurin B homologous protein 2
Organism
ecb  Equus caballus (horse)
Brite
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100069148 (CHP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 191 aa AA seqDB search
MASLQRTDVHRSAFLPAFSQAIFLRLYHRFRALDTNKKDYLSRMDLQQIGALAVNPLGDR
IIDSFFPDGSLQVDFPDFVRVLAHFRPADDEDAGLRDPREPEPLNSRMNKLRFAFQLYDL
DRDGKISRHEMLQVLRLMVGVQVTEEQLESIAERTVQEADEDGDGAVSFLEFAKSLEKMD
IEQKMSIRILK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggcctccttacagaggaccgacgtccaccgctctgcctttcttcccgcattctctcag
gccatatttctacgcctctaccaccggtttcgggccctggacacgaacaagaaggactac
ctgagccgcatggatctgcagcagattggggcgctggccgtgaaccccctgggagaccgc
attatagacagcttcttccctgatgggagtctgcaagtggatttcccagactttgtcagg
gtcctggctcattttcgacctgcagacgatgaggacgcaggactccgggaccccagggaa
cctgaacccctcaacagcagaatgaacaaacttcgctttgcatttcagctctacgacctg
gatcgggatggaaagatctccaggcatgagatgctacaggtactccggctgatggtcgga
gtacaggtgacggaagagcagttggagagcatcgccgagcgcacggtgcaggaggccgat
gaagatggcgatggggctgtgtccttcctggagtttgccaagtccttagagaagatggac
atcgagcagaaaatgagcatccggatcctgaagtga

DBGET integrated database retrieval system