KEGG   Equus caballus (horse): 100069399Help
Entry
100069399         CDS       T01058                                 

Gene name
HIBCH
Definition
3-hydroxyisobutyryl-CoA hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ecb  Equus caballus (horse)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100069399 (HIBCH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100069399 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100069399 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100069399 (HIBCH)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100069399 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 408 aa AA seqDB search
MALFHPTFQGADWLEFALIGLSSDLGFGMLTRALRFNSFRRTHVILQHLRMSKHTDAAEV
LLERKGCAGVITLNRPKLLNTLTVGMIRQIYTQLKKWEQDPETFLIIIKGAGGKAFCAGG
DIRAISEIGNKNQKILQDFFREEYMLNNYIASYRKPYVALIHGITMGGGVGVSVHGQFRV
ATEKSLFAMPETAIGLFPDVGGGYFLPRLQGKLGYFLGLTGFRLKGRDVYTAGIATHFVD
SEKLDTLEEDLSALKAPSSENVADVLETYHTKSKIDRDKSFILEEHMDKINSCFSANTVE
QIIENLRQDGSSFALEQLKVINKMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQSCMR
GHDFYEGVRALLIDKDQSPKWKPADLKEVTDEDLNNHFKSLGHNDLKF
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctttattccaccccacatttcaaggtgccgactggttagagtttgctttaattggt
cttagtagtgacctgggctttggaatgctcacaagagccctcaggtttaattcattcaga
aggactcatgtcatactgcaacacttgagaatgtcaaagcacacagatgcagcagaagta
ctattggaaagaaaaggttgtgcaggagtgataacactaaacagaccaaagttactaaat
acactgactgtcggtatgattcggcagatttatacacagctaaagaagtgggaacaagat
cctgaaactttcctgatcattataaagggagctggagggaaggctttctgtgctgggggt
gatatcagagcaatttcagaaattggaaataaaaaccagaagatacttcaagatttcttc
agagaagaatatatgctgaacaattatattgcttcttaccggaagccatatgttgcactt
attcatggaattacaatgggtgggggagttggtgtctcagttcatgggcagttccgagtg
gctactgaaaagtctctttttgcaatgccagaaacagcaataggactatttcctgatgtg
ggtggaggttatttcttgccacgacttcaaggaaaacttggttacttccttggattaaca
ggattcaggctaaaaggaagagatgtgtacacagcaggcattgccacgcactttgtagat
tctgaaaagttggacacgttagaagaagatttatcagccctgaaggctccttcaagtgaa
aatgttgcagatgtcttagaaacttaccatacaaagtccaagattgatcgagacaagtcc
tttatacttgaggaacacatggacaaaataaacagttgtttctcggccaatactgtggaa
cagattattgaaaatttacggcaagatggttcatcttttgccctagagcagttgaaggta
attaataaaatgtctccaacatcattaaagatcacactaagacaactcatggagggctcc
tcaaagaccttgcaagaggtattaactatggaatatcggctgagccaatcttgtatgaga
ggccatgacttttatgaaggcgttagggcacttttaatagataaagaccagagtccgaag
tggaaaccagctgatttaaaagaagttactgatgaagatttgaataatcactttaaatct
ctgggacacaatgatttgaaattttga

DBGET integrated database retrieval system