KEGG   Equus caballus (horse): 100069617Help
Entry
100069617         CDS       T01058                                 

Gene name
GLS
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ecb  Equus caballus (horse)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100069617 (GLS)
   00330 Arginine and proline metabolism
    100069617 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100069617 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100069617 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    100069617 (GLS)
   04727 GABAergic synapse
    100069617 (GLS)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100069617 (GLS)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100069617 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 629 aa AA seqDB search
MMQPARLGDAAGTCSCDRPQPLAPLLRRVSPSGPWSRRPRSGGRRGLRVREAAARHYPEG
GRGRTGLAESPNGLCRAICFTGNSVSETSKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFI
TALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFV
IPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKV
PFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIV
VTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKC
FPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPISGERVLSPEAVRNTLSLM
HSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHD
LVSLCNFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDME
QRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQ
EYQVQYTPQGDSDNGKENQTVHKNLDGLL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcctgcaaggctcggcgatgctgcgggaacttgctcctgcgaccgcccgcag
ccgcttgcgccgctcttgaggcgggtcagcccctccggaccttggagccggcgcccccgg
agcggaggaaggcgcggcttacgagttcgggaggctgctgcacgacactacccagaaggg
gggcgggggcggaccggactggcggaatcccctaatggcctgtgtagagccatctgtttt
accggaaatagtgtttctgaaacgagtaaaataaaacagggtctgttacctagcttggaa
gatttgctgttctatacaattgcagaaggacaagagaaaatacctgttcataaatttatt
acagcactcaaatctacaggattgcgaacgtctgatcccaggttgaaagagtgtatggat
atgttaagattaactcttcaaacaacatcagatggtgtcatgctagacaaagatcttttt
aaaaaatgtgttcaaagcaacattgttttgttgacacaagcgtttagaagaaagtttgtc
attcctgactttatgtcttttacctcacacattgatgagttatatgaaagtgctaaaaag
cagtctggaggaaaggttgcagattatattcctcaactagccaaattcagtcctgatttg
tggggtgtatccgtttgtacagtagatggacagaggcattctattggagataccaaagtt
ccattttgtcttcagtcctgtgtaaaacctttgaaatatgccattgctgttaatgatctt
ggaacagaatacgtgcatcgatatgttgggaaagagccaagtggattaagattcaacaaa
ctgtttttaaatgaagatgataagcctcacaatcctatggtaaatgctggagcaattgtt
gtgacttcattaataaagcaaggagtgaataatgctgaaaaatttgactatgtgatgcag
tttttgaataagatggctggtaatgaatatgttggattcagtaatgcaacgtttcagtcc
gaaagagaaagtggagatcgaaattttgcaataggatattacttaaaagaaaaaaagtgt
tttccagaaggcacagacatggttggtatattagacttctacttccagctgtgctccatt
gaagtaacttgtgaatcagctagtgtcatggctgcgacactggctaatggtggtttctgc
ccaatttctggtgaaagagtactgagccctgaggcagttcgaaatacgttgagtttgatg
cattcctgtggcatgtatgatttctcagggcaatttgctttccatgttggtcttcctgca
aaatctggagttgctggaggcattcttttagttgtccccaatgtcatgggtatgatgtgc
tggtctcctcctctggacaagatgggcaacagtgttaaaggaattcacttctgtcatgat
cttgtttctctgtgtaatttccataactacgataatttgagacactttgcaaaaaaactt
gatcctcgaagagaaggtggtgatcaaagggtaaagtcagtgataaaccttttgtttgct
gcgtacactggagatgtgtctgcacttcgaagatttgctttgtcagccatggatatggaa
cagcgagactatgattctagaacagcactccacgtagctgccgcagagggtcatgttgaa
gttgttaaatttttgctggaagcctgcaaagtaaatcctttcccgaaagacaggtggaat
aacactcccatggacgaagcactgcacttcgggcaccatgatgtatttaaaatcctccag
gagtaccaagtccagtacacacctcaaggagactccgacaatgggaaggaaaatcaaacc
gtccataagaatctcgatggattgttataa

DBGET integrated database retrieval system