KEGG   Equus caballus (horse): 100069663Help
Entry
100069663         CDS       T01058                                 

Gene name
LAMC3
Definition
laminin, gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
ecb  Equus caballus (horse)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100069663 (LAMC3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100069663 (LAMC3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100069663 (LAMC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100069663 (LAMC3)
   05222 Small cell lung cancer
    100069663 (LAMC3)
  Infectious diseases
   05146 Amoebiasis
    100069663 (LAMC3)
   05145 Toxoplasmosis
    100069663 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
25
AA seq 1458 aa AA seqDB search
NITLRLGKAYEITYVRLKFHTSRPESFAIYKRSRAGGPWEPYQYYSASCQKTYGRPEGQY
LRPGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPVLQEWVTSTELLISL
DRLNTFGDDIFKDPRVLQSYYYAVSDFSVGGRCKCHGHASACGPDAAGRLVCLCQHNTTG
TDCERCRPFFQDRPWARGTAEAANECLPCNCSGHSEECTFDRELFRSTGHGGRCLRCRDH
TAGPHCERCQENFYRWDRRTPCQPCDCHPAGSLRLQCDDAGTCVCKPTVTGWKCDRCLPG
FHSLSEGGCRPCTCNPAGSLGTCDPRSGRCPCKENVEGNLCDRCRPGTFNLQPHNPAGCS
SCFCYGHSKVCAAAAGFREHHILSDFRQGAEGWQVGSMGGPEHPARWRPGGLPLNLGDEE
ELAAPEKFLGDQRFSYGQPLTLTFRGPPGGSPLPVQLRLEGAGLALSLRHSSPSGPRDAG
QPGEVQLHFQLQETSEDVDPPLPPFHFQRLLTNLTALRIQASSRGRSPPGQMFLMEVRLT
SAQRGLSPPASWVETCSCPKGYTGQFCESCAPGYKRETPLGGPYANCVPCTCNQHGTCDP
NTGICLCGHHTEGPSCERCLPGFYGNPFTGRADDCQPCPCPGQSACTTIPESREVVCTHC
PPGQRGRRCETCDDGFFGDPLGLSGAPQPCQQCQCSGNIDPNTVGNCDPLSGHCLRCLHN
TTGAHCEHCQDGYYGSALAPRPADKCMPCSCNPGGSVSEQRPCDPVTGQCSCLPHVTGRD
CGLCSPGFYDLQPGRGCQSCKCHPLGSQEDQCHPKTGQCPCRPGVEGQACDRCQLGFFGF
SVKGCRACRCSPLGAASAQCHENSTCVCRPGFVGYKCDRCQDNFFLTASGTHCQECPSCY
SLVKEEVAKLKARLTLMEGWLQGSDCGITWGPLDILQGEAPRGDVYQGHHLVQGAREAFL
EQVTGLEGAVKAAREQLRALSRKARCAQARAGKTCIQLADLEAALESSEEEILHAATVLA
SLVIPQEGLGQPTNWSHLAAEARVLARSHRATATKIKATAQRALLASNTSYVLLWSLLEG
KVALEAQQELEDRYQAVQEAQKELGAAVAEALPEAERVLAAVQQVVTDTGLRPASLPVPV
ALPQAARAGDLDPRLQALEKTVASRERVVTEAARALQATARAALHKAEPLTQLHQEARAA
LTRASSSVHAATVTVVGARTLLADLEGMKLRFPLPEDQAALMRKAGLVQDRILADARKKT
KQAERMLGNAASVSSSARKKGREAELLAKDSAKLAKALLREGKQEYRRAGRLSSQTQATL
RQASRQALALGARGRELEEAEQVGAGLSKVERQIRESRLSLEKDIEALTELLDRLGSLDT
HQTPAQALNETQRALERLRLQLGPPGALQGKLRLLEQESEQQELQIQSFESNLAEIRADK
QNLEAILHSLPESCANQQ
NT seq 4377 nt NT seq  +upstreamnt  +downstreamnt
aacatcaccctccgcctggggaaagcttacgagatcacctacgtgaggctgaagttccac
accagtcgccccgagagcttcgccatctacaagcgcagccgggcgggcggcccgtgggag
ccctaccagtactacagcgcctcctgccagaagacctacggccggcccgagggccagtac
ctgcggcccggcgaggacgagcgcgtggccttctgcacctcggagttcagtgacatctcc
ccgctcagtgggggcaacgtggccttctccactctggagggccggcccagcgcctacaat
tttgaggagagccccgtgctgcaggagtgggtcaccagcacggagctgctcatctccctg
gaccggctcaacacttttggggacgacatcttcaaggaccccagggtgctgcagtcctac
tactatgccgtgtctgacttctccgtgggtggcaggtgcaagtgtcatgggcacgcgagt
gcgtgcggccccgatgcggcgggccggctggtgtgcctctgccagcacaacaccacgggc
acagactgcgagcgctgccggcccttcttccaggaccgcccgtgggcccgcggcacggcc
gaggccgccaacgagtgtctgccctgcaactgcagtggccactctgaggagtgcaccttt
gaccgggagctcttccgcagcacgggccacggtgggcgctgcctccgctgccgtgaccac
acggctgggccgcactgcgagcgctgccaggagaacttctatcgctgggaccggcgaaca
ccgtgccagccctgcgactgccacccagcaggctccctgcgcctccagtgcgatgatgcg
ggcacctgcgtctgcaagcccactgtgacgggctggaagtgtgaccgatgcctgcccggg
ttccactcgctcagtgagggcggctgcagaccctgcacctgcaatcctgctggcagcctg
ggcacctgtgacccccgcagtgggcgctgcccctgcaaagagaatgtggaaggcaacctg
tgtgacagatgccgcccggggacattcaacctgcagccccacaacccggccggctgcagc
agctgcttctgctatggccactccaaggtgtgtgcggccgccgccgggttccgggagcac
cacatcctctccgacttccgccagggagctgaaggctggcaggttggaagcatggggggc
ccagagcatccagcacgatggaggccaggggggctccccctgaacctgggagatgaggag
gagctcgcagcgccagagaagttcctgggagaccagcggttcagctatgggcagcccctt
acgctcaccttccggggcccccctgggggctccccgctccccgtgcagctgaggctggaa
ggggcgggcctggccctgtctctgcggcattccagcccgtccggcccccgggacgccggg
cagcctggggaggtacagctgcacttccagctgcaggagacctccgaggacgtggaccct
ccgctgccccccttccacttccagcggctgctcaccaatctgaccgcccttcgcatccaa
gccagcagccgaggccgaagccctcccggccagatgttcctgatggaggtccggctcacg
tcggcccagcgggggctgtcccccccagcctcctgggtggagacctgctcgtgtcccaag
gggtacacgggccagttctgtgaatcttgtgccccaggatataagagggagacaccactg
gggggtccctatgccaactgtgttccctgcacctgtaaccagcatggcacctgtgacccc
aacacggggatctgcctgtgtggccaccacaccgagggcccgtcctgcgagcgctgcttg
ccgggtttctatggcaaccccttcacaggccgagccgacgactgccagccctgtccgtgc
ccgggacagtcggcctgcacgaccatcccagagagcagggaggtggtgtgtacccactgc
cccccgggccagagagggcggcgctgtgagacctgtgatgatggcttttttggggaccca
ctggggctctctggagccccccagccctgccagcagtgccagtgcagcgggaatatagac
cccaacaccgtgggcaactgtgaccccctgtctggccactgcctgcgttgcctgcacaac
acaacaggtgctcactgtgagcactgtcaggatggctactatgggagcgccctggcccct
cggcccgcagacaaatgcatgccctgcagctgcaacccggggggctcagtcagtgagcag
agaccctgcgacccagtgaccggccagtgctcctgcctgcctcatgtgactggacgggac
tgtggcctctgcagccctggcttctacgacctccagcctgggaggggctgccagagctgc
aaatgccacccgctgggctcccaggaggaccagtgtcaccctaagaccgggcagtgcccc
tgtcgcccgggtgtcgagggccaggcctgcgacagatgccagctgggtttctttggcttc
tctgtcaagggctgccgggcctgcaggtgctccccgttgggcgccgcctcggcccaatgc
cacgagaacagcacctgcgtgtgcaggcccggcttcgtgggctacaagtgtgaccgctgc
caggacaacttcttcctcacggccagcggcacgcactgccaggagtgcccgtcgtgttac
tctctggtgaaggaggaggttgccaagctgaaggccaggctgaccctgatggaggggtgg
ctgcaggggtctgactgtggcataacctggggaccgctggacattctgcagggagaagcc
ccacggggggacgtctaccagggccaccacctggtgcaaggggcccgggaagccttcctg
gagcaggtgacaggcctcgagggtgctgtgaaggctgccagggagcagctccgggcgctg
agcaggaaggcacgctgtgcccaggccagagccgggaagacctgcatccagctggcagac
ctagaggcagcgctggagtcttcagaagaggagattctgcatgcagccaccgtcctggcg
tctctggtgatacctcaggaggggcttggccagcccaccaactggagccacctggccgca
gaagcccgtgtccttgccaggagccacagggccaccgccaccaagatcaaggccactgct
cagagggccctgctcgcctccaacaccagttatgtgcttctctggagtctgctggagggc
aaagtggccctggaggcccagcaggagctggaggacaggtaccaggcggtgcaggaggcc
cagaaggagctgggcgcggctgtggcagaggcgctgcccgaagccgagagagtactggcc
gccgtgcagcaagttgtcacagacacgggcctgcggccggcctcgctgcctgtccctgtg
gcactgcctcaggcggctcgggctggggacctggacccgaggctgcaggctctggagaag
acagtcgcatcgagagagcgcgtggtcaccgaggctgcgcgggccctccaggccaccgcc
cgggctgcactgcacaaggccgagcccctcacgcagctgcaccaggaggccagagccgcc
ctgacccgggcttcctcgtccgtccacgctgccacagtgaccgttgtgggagccaggacc
ctgctggctgacctggaaggaatgaagctgcggtttcctctgcccgaggaccaggccgcg
ttgatgaggaaggcgggtctcgtccaggacaggatcctcgcggacgcgcgaaagaagacc
aagcaggcggagaggatgctgggaaacgcggcgtctgtctcctccagcgccaggaagaag
ggcagggaagccgagctgttggccaaggacagcgccaagctcgccaaggccttgctgcgg
gaggggaagcaggaataccgccgagccggccggctgtccagccagacccaggcgacgctg
cgacaggcctcccgccaggcgctggccctgggagcgcgtggacgggagctggaggaggcc
gagcaggtgggtgccgggctgagcaaggtggagcggcagatccgggaatcgcgcctctcc
ctggagaaggacatcgaggccttgacggagctgctggacaggctggggtcgctggacacc
catcaaaccccagcccaggccctgaacgagacccagcgggcactggagcgcctgaggctg
cagctgggcccacccggggccctgcaggggaaactgaggctcttggagcaggagtcggag
cagcaggagctgcagatccagagttttgagagcaacctcgccgagatccgcgccgacaag
cagaacttggaggccattctgcacagcctgcctgagagctgtgccaaccagcagtga

DBGET integrated database retrieval system