KEGG   Equus caballus (horse): 100070088Help
Entry
100070088         CDS       T01058                                 

Definition
cytochrome P450 1B1-like
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Ovarian steroidogenesis
Chemical carcinogenesis
MicroRNAs in cancer
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ecb00140]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ecb00380]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:ecb00980]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:ecb04913]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:ecb05206]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:ecb05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 543 aa AA seqDB search
MATSLSLDDPLLPISLSTQQTTLLLFLSALAAVHVGQWLLRQRRRQPGCAPPGPFAWPLI
GNAAAMGPAPHLAFARLARRYGDVFQIRLGSCPVVVLNGERAIRQALVQQGAAFADRPPF
ASFRVVSGGHSLAFSQYSEHWKVHRRAAHSTMRAFSTRQPRSRRVLEGHVLGEARELVAL
LVRGSAGGAFLDPVPLTVVAVANVMSAVCFGCRYNHDDAEFLELLSHNEKFGRTVGAGSL
VDVLPWLQLFPNPVRTAFREFEQLNRNFSNFVLNKFLSHRESLRPGAAPRDMMDAFILSA
GKEAAEGSGDGGARLDMEYVPGTVTDIFGASQDTLSTALQWLLILFTRYPEVQARVQAEL
DQVVGRDRLPCLDDQPKLPYVMAFLYEAMRFSSFVPVTIPHATTANASVLGYHIPKDTVV
FVNQWSVNHDPVKWPNPEDFDPARFLDKDGSINRDLASSVMIFSVGKRRCIGEELSKMQL
FLFISILAHECNIKANPDELSKMDFHYGLTIKPKSFKINVTLRESMELLDSAVQKLQAEE
DSQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccactagcctcagcctggacgatcctctactgccgatctcgctgtccacccagcag
accacgctcctgctgttcctctcggcgctagccgccgtgcacgtgggccagtggctgctg
aggcagcggcggcgacagccagggtgcgcgccccccggcccctttgcgtggccgctgatc
ggaaatgcggcggctatgggccctgcgccgcacctcgcattcgcgcgcctggcgcgacgc
tacggcgacgtcttccagatccgcctgggcagctgcccagtggtggtgctgaacggcgag
cgcgccatccgccaggccctggtgcagcagggcgctgccttcgccgaccggccgcccttc
gcctctttccgcgtggtgtccggcggccacagcctggctttcagccagtactctgagcat
tggaaggtgcatcggcgcgcagcgcacagcacgatgcgagccttctccacgcgccagccg
cgcagccgccgcgtcctcgagggccacgtgctaggcgaggcgcgcgagttggtggcgctg
ctggtgcgcggcagcgccggcggcgccttcctcgacccggtgccgctgaccgtggtggcc
gtggccaacgttatgagcgccgtgtgcttcggctgccgctacaaccacgacgacgccgag
ttcctcgagctgctcagccacaacgagaagttcgggcgcacggtgggcgcgggcagcctc
gtggacgtgctgccctggctgcagctcttcccaaacccggtgcgcactgccttccgcgaa
ttcgagcagctcaaccgcaacttcagcaacttcgtcctcaacaagttcctgagccaccgt
gaaagccttcggccgggggccgccccccgagacatgatggacgccttcatcctctccgct
ggaaaggaggcggctgagggctcgggcgacggcggcgcgcggctggacatggagtacgta
cccggcactgtcaccgacatcttcggcgccagccaggacactctctccactgcgctgcag
tggctgctcatccttttcaccaggtatcctgaagtgcaggctcgggtccaggcagaattg
gatcaggtcgtgggtagggaccgtctcccctgcctggatgaccagcccaagctgccctat
gtcatggcctttctctatgaagccatgcgcttctccagctttgtgcccgtcaccattcct
cacgccaccactgccaatgcctctgtcttgggctaccacattcccaaggacacggtggtt
tttgttaatcagtggtctgtgaatcatgacccagtgaagtggcctaaccccgaagacttc
gatccagcccgcttcttggacaaggacggctccatcaacagggacctggccagcagcgtg
atgattttttcagtgggcaaacggcggtgcatcggggaggagctttccaagatgcagctg
tttctcttcatctccatcctggctcacgagtgcaatatcaaggccaatccagacgagctc
tcgaaaatggattttcattatggcctgaccattaaacccaagtcatttaaaatcaatgtc
accctcagggagtccatggagctccttgatagtgctgtccaaaagttacaggccgaggaa
gacagccagtga

DBGET integrated database retrieval system