KEGG   Equus caballus (horse): 100070088Help
Entry
100070088         CDS       T01058                                 

Definition
cytochrome P450 1B1-like
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Ovarian steroidogenesis
Chemical carcinogenesis
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100070088
  Amino acid metabolism
   00380 Tryptophan metabolism
    100070088
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100070088
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100070088
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100070088
   05204 Chemical carcinogenesis
    100070088
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100070088
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP1 family
   100070088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 543 aa AA seqDB search
MATSLSLDDPLLPISLSTQQTTLLLFLSALAAVHVGQWLLRQRRRQPGCAPPGPFAWPLI
GNAAAMGPAPHLAFARLARRYGDVFQIRLGSCPVVVLNGERAIRQALVQQGAAFADRPPF
ASFRVVSGGHSLAFSQYSEHWKVHRRAAHSTMRAFSTRQPRSRRVLEGHVLGEARELVAL
LVRGSAGGAFLDPVPLTVVAVANVMSAVCFGCRYNHDDAEFLELLSHNEKFGRTVGAGSL
VDVLPWLQLFPNPVRTAFREFEQLNRNFSNFVLNKFLSHRESLRPGAAPRDMMDAFILSA
GKEAAEGSGDGGARLDMEYVPGTVTDIFGASQDTLSTALQWLLILFTRYPEVQARVQAEL
DQVVGRDRLPCLDDQPKLPYVMAFLYEAMRFSSFVPVTIPHATTANASVLGYHIPKDTVV
FVNQWSVNHDPVKWPNPEDFDPARFLDKDGSINRDLASSVMIFSVGKRRCIGEELSKMQL
FLFISILAHECNIKANPDELSKMDFHYGLTIKPKSFKINVTLRESMELLDSAVQKLQAEE
DSQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccactagcctcagcctggacgatcctctactgccgatctcgctgtccacccagcag
accacgctcctgctgttcctctcggcgctagccgccgtgcacgtgggccagtggctgctg
aggcagcggcggcgacagccagggtgcgcgccccccggcccctttgcgtggccgctgatc
ggaaatgcggcggctatgggccctgcgccgcacctcgcattcgcgcgcctggcgcgacgc
tacggcgacgtcttccagatccgcctgggcagctgcccagtggtggtgctgaacggcgag
cgcgccatccgccaggccctggtgcagcagggcgctgccttcgccgaccggccgcccttc
gcctctttccgcgtggtgtccggcggccacagcctggctttcagccagtactctgagcat
tggaaggtgcatcggcgcgcagcgcacagcacgatgcgagccttctccacgcgccagccg
cgcagccgccgcgtcctcgagggccacgtgctaggcgaggcgcgcgagttggtggcgctg
ctggtgcgcggcagcgccggcggcgccttcctcgacccggtgccgctgaccgtggtggcc
gtggccaacgttatgagcgccgtgtgcttcggctgccgctacaaccacgacgacgccgag
ttcctcgagctgctcagccacaacgagaagttcgggcgcacggtgggcgcgggcagcctc
gtggacgtgctgccctggctgcagctcttcccaaacccggtgcgcactgccttccgcgaa
ttcgagcagctcaaccgcaacttcagcaacttcgtcctcaacaagttcctgagccaccgt
gaaagccttcggccgggggccgccccccgagacatgatggacgccttcatcctctccgct
ggaaaggaggcggctgagggctcgggcgacggcggcgcgcggctggacatggagtacgta
cccggcactgtcaccgacatcttcggcgccagccaggacactctctccactgcgctgcag
tggctgctcatccttttcaccaggtatcctgaagtgcaggctcgggtccaggcagaattg
gatcaggtcgtgggtagggaccgtctcccctgcctggatgaccagcccaagctgccctat
gtcatggcctttctctatgaagccatgcgcttctccagctttgtgcccgtcaccattcct
cacgccaccactgccaatgcctctgtcttgggctaccacattcccaaggacacggtggtt
tttgttaatcagtggtctgtgaatcatgacccagtgaagtggcctaaccccgaagacttc
gatccagcccgcttcttggacaaggacggctccatcaacagggacctggccagcagcgtg
atgattttttcagtgggcaaacggcggtgcatcggggaggagctttccaagatgcagctg
tttctcttcatctccatcctggctcacgagtgcaatatcaaggccaatccagacgagctc
tcgaaaatggattttcattatggcctgaccattaaacccaagtcatttaaaatcaatgtc
accctcagggagtccatggagctccttgatagtgctgtccaaaagttacaggccgaggaa
gacagccagtga

DBGET integrated database retrieval system