KEGG   Equus caballus (horse): 100070088Help
Entry
100070088         CDS       T01058                                 

Gene name
CYP1B1
Definition
(RefSeq) cytochrome P450 1B1
  KO
K07410  cytochrome P450 family 1 subfamily B polypeptide 1 [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00140  Steroid hormone biosynthesis
ecb00380  Tryptophan metabolism
ecb00980  Metabolism of xenobiotics by cytochrome P450
ecb04913  Ovarian steroidogenesis
ecb05204  Chemical carcinogenesis
ecb05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100070088 (CYP1B1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    100070088 (CYP1B1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100070088 (CYP1B1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100070088 (CYP1B1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100070088 (CYP1B1)
   05204 Chemical carcinogenesis
    100070088 (CYP1B1)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100070088 (CYP1B1)
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP1 family
   100070088 (CYP1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100070088
NCBI-ProteinID: XP_001499815
Ensembl: ENSECAG00000019442
UniProt: F7E336
Position
15
AA seq 543 aa AA seqDB search
MATSLSLDDPLLPISLSTQQTTLLLFLSALAAVHVGQWLLRQRRRQPGCAPPGPFAWPLI
GNAAAMGPAPHLAFARLARRYGDVFQIRLGSCPVVVLNGERAIRQALVQQGAAFADRPPF
ASFRVVSGGHSLAFSQYSEHWKVHRRAAHSTMRAFSTRQPRSRRVLEGHVLGEARELVAL
LVRGSAGGAFLDPVPLTVVAVANVMSAVCFGCRYNHDDAEFLELLSHNEKFGRTVGAGSL
VDVLPWLQLFPNPVRTAFREFEQLNRNFSNFVLNKFLSHRESLRPGAAPRDMMDAFILSA
GKEAAEGSGDGGARLDMEYVPGTVTDIFGASQDTLSTALQWLLILFTRYPEVQARVQAEL
DQVVGRDRLPCLDDQPKLPYVMAFLYEAMRFSSFVPVTIPHATTANASVLGYHIPKDTVV
FVNQWSVNHDPVKWPNPEDFDPARFLDKDGSINRDLASSVMIFSVGKRRCIGEELSKMQL
FLFISILAHECNIKANPDELSKMDFHYGLTIKPKSFKINVTLRESMELLDSAVQKLQAEE
DSQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccactagcctcagcctggacgatcctctactgccgatctcgctgtccacccagcag
accacgctcctgctgttcctctcggcgctagccgccgtgcacgtgggccagtggctgctg
aggcagcggcggcgacagccagggtgcgcgccccccggcccctttgcgtggccgctgatc
ggaaatgcggcggctatgggccctgcgccgcacctcgcattcgcgcgcctggcgcgacgc
tacggcgacgtcttccagatccgcctgggcagctgcccagtggtggtgctgaacggcgag
cgcgccatccgccaggccctggtgcagcagggcgctgccttcgccgaccggccgcccttc
gcctctttccgcgtggtgtccggcggccacagcctggctttcagccagtactctgagcat
tggaaggtgcatcggcgcgcagcgcacagcacgatgcgagccttctccacgcgccagccg
cgcagccgccgcgtcctcgagggccacgtgctaggcgaggcgcgcgagttggtggcgctg
ctggtgcgcggcagcgccggcggcgccttcctcgacccggtgccgctgaccgtggtggcc
gtggccaacgttatgagcgccgtgtgcttcggctgccgctacaaccacgacgacgccgag
ttcctcgagctgctcagccacaacgagaagttcgggcgcacggtgggcgcgggcagcctc
gtggacgtgctgccctggctgcagctcttcccaaacccggtgcgcactgccttccgcgaa
ttcgagcagctcaaccgcaacttcagcaacttcgtcctcaacaagttcctgagccaccgt
gaaagccttcggccgggggccgccccccgagacatgatggacgccttcatcctctccgct
ggaaaggaggcggctgagggctcgggcgacggcggcgcgcggctggacatggagtacgta
cccggcactgtcaccgacatcttcggcgccagccaggacactctctccactgcgctgcag
tggctgctcatccttttcaccaggtatcctgaagtgcaggctcgggtccaggcagaattg
gatcaggtcgtgggtagggaccgtctcccctgcctggatgaccagcccaagctgccctat
gtcatggcctttctctatgaagccatgcgcttctccagctttgtgcccgtcaccattcct
cacgccaccactgccaatgcctctgtcttgggctaccacattcccaaggacacggtggtt
tttgttaatcagtggtctgtgaatcatgacccagtgaagtggcctaaccccgaagacttc
gatccagcccgcttcttggacaaggacggctccatcaacagggacctggccagcagcgtg
atgattttttcagtgggcaaacggcggtgcatcggggaggagctttccaagatgcagctg
tttctcttcatctccatcctggctcacgagtgcaatatcaaggccaatccagacgagctc
tcgaaaatggattttcattatggcctgaccattaaacccaagtcatttaaaatcaatgtc
accctcagggagtccatggagctccttgatagtgctgtccaaaagttacaggccgaggaa
gacagccagtga

DBGET integrated database retrieval system