KEGG   Equus caballus (horse): 100070208Help
Entry
100070208         CDS       T01058                                 

Gene name
USP10
Definition
(RefSeq) ubiquitin specific peptidase 10
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100070208 (USP10)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100070208 (USP10)
Ubiquitin system [BR:ecb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100070208 (USP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 826 aa AA seqDB search
MATAFAGFAFAPSLHHINHKRPVLSFTLARQSRKYIFGDFSPDEFNQFFVAPRCSVELPP
YNGTVLCGVQAADDLPDGQEYQRIEFGVNEVIESNGALPRTPNYSISSTLNPQAPEFILS
CTASTKTPDDPDKEANYSSTDCPDPGSALALDGSSNLEAEVLENDSVSGGLGQRERKKKK
KRPPGYYSYLKDGGEGSVSAEALVNGHANPAVPNNLGTEEAESMGDVPRSGTPRTCSSPQ
DSTDFVSDTVPGGSFPEALDNDARTAGQPEGCPRADLEQSCLPAEAGRDSLLRTAVAQPY
IGTDTTENLGVANGQILESLGEGTAANGVELHTVESPDSDPAKAEGASPPGDALASAMGA
APASQPAKSWASLFHDSKPSSSLPVASVETKYSPPATSPLVSEKQAEVKEGLVPVSEDPV
AIKIAELLENVTLIHKPVSLQPRGLINKGNWCYINATLQALVACPPMYHLMKFIPLYSKV
QRPCTSTPMIDSFVRLMNEFTNMPVPPKPRQALGDKIVRDIRPGAAFEPTYIYRLLTVIK
SSLSEKGRQEDAEEYLGFILNGLHEEMLNLKKLLSPSNEKLTISNGPKSHSVNEDEQEEP
DEGSEDEWEQVGPRNKTSVTRQADFVQTPITGIFGGHIRSVVYQQSSKESATLQPFFTLQ
LDIQSDKIRTVQDALESLVARESVQGYTTKTKQEVEISRRVTLEKLPPVLVLHLKRFVYE
KTGGCQKLVKNIEYPVDLEISKELLSPGVKNKNLKCHRTYRLFAVVYHHGSSATGGHYTT
DVFQIGLNGWLRIDDQMVKVVNQYQVVKPTADRTAYLLYYRRVDLL
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcatttgcaggcttcgcctttgctcccagcctccaccacatcaaccacaag
agacctgtcctctccttcaccctggcccggcaaagcagaaagtatatttttggagatttt
agccctgacgaattcaatcagttctttgtggcccctcgctgttcagttgagcttcctcca
tacaatgggacagtgctgtgtggcgtgcaggctgcagatgacctacctgatggacaagaa
tatcagagaattgagtttggtgtgaatgaagtaattgaatccaatggcgctttgccgaga
acgcccaactacagtatttcgagcacattgaatcctcaggcccccgaatttattcttagt
tgcacagcttccaccaagacccctgacgacccggataaagaagcgaactacagctccact
gactgcccggacccaggctctgctcttgctctggatggcagctctaacctggaggcggaa
gtgttggaaaatgacagcgtctccggtggtcttggacaaagggagcgtaaaaagaagaag
aaacgtccacctgggtattacagttacttgaaagatggcggtgagggcagcgtttccgca
gaagccctggtcaacggccatgccaatccagcagtcccgaacaacttaggcacagaggaa
gcagagtcgatgggcgatgtgccccggtcggggacgcccaggacttgtagcagccctcag
gactccacggactttgtcagtgacactgtgcctggtggttctttccctgaagccctcgac
aacgatgccaggactgcagggcagcctgagggctgccccagggctgacttggaacagtcc
tgcctccctgcagaggctggcagggacagcctgttgaggacagctgtggctcagccttac
attgggactgatactactgaaaatcttggagttgctaatggacaaatacttgaatccttg
ggtgagggcacagctgccaacggggtggagttgcacactgtggaaagcccggactcggac
cctgctaaagccgagggtgcttcccctcctggtgacgccctggcctcggccatgggcgct
gctcccgccagtcagcctgctaagtcatgggccagtctttttcatgattctaagccctct
tcctccttgcctgtggcttctgtggaaactaagtattcccctcctgccacgtctcccctg
gtctctgaaaagcaggccgaagtcaaggaagggcttgttccagtttcagaggatcctgta
gccataaagattgcagagttactggagaatgtaaccctaatacataaaccagtgtcattg
caaccccgtgggctgatcaataaaggaaactggtgctacattaacgctacgctgcaggcc
ctggtagcctgccctccgatgtaccacctgatgaagttcattcctctgtactcaaaagtg
cagaggccttgtacatcgacacccatgatagatagctttgtccggctaatgaacgagttt
actaatatgccagtacctccaaaacccagacaagctcttggggataaaattgtgagagat
atccgccctggagctgcctttgaacccacgtatatttatagactcctgaccgtcatcaag
tcgagcttgtctgaaaagggccgacaggaagatgccgaggagtacttaggcttcattctg
aacggacttcacgaggagatgttgaacctaaagaaacttctttcaccgagtaatgaaaaa
cttactatttccaatggacccaaaagccactcagtgaacgaagatgagcaggaagaaccc
gatgaaggaagtgaggacgagtgggaacaagtgggccccagaaataagacttcagtcact
cgccaggccgattttgttcagaccccaatcaccggcatttttggtggacacatcaggtct
gtggtttaccagcaaagttcaaaagaatctgccactttgcagccatttttcacgttgcag
ttggatatccagtctgacaagatacggacagtccaggatgcattggaaagcttggtggcg
agagaatcagtccaaggttataccacaaaaaccaaacaagaggtcgagatcagtcggaga
gtgactctggaaaagctccctcctgttctcgtgctccacctgaagcgctttgtttacgag
aagactggtggctgtcagaagctcgtcaaaaacatcgaataccctgtggacttggaaatc
agtaaagagctgctttctccaggagttaaaaataagaatttgaaatgccacagaacctac
aggctgtttgcggtggtctaccaccacggcagcagcgcgacgggcggccactacaccaca
gacgtcttccagatcggcctgaacggctggctgcgcatcgacgaccagatggtcaaagtg
gttaaccagtaccaggtggtgaagcccactgctgaccgcacagcctacctcctgtactac
cgccgcgtggacctgctgtga

DBGET integrated database retrieval system