KEGG   Equus caballus (horse): 100070281Help
Entry
100070281         CDS       T01058                                 

Gene name
HDAC1
Definition
histone deacetylase 1
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ecb  Equus caballus (horse)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100070281 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100070281 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100070281 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100070281 (HDAC1)
   05202 Transcriptional misregulation in cancers
    100070281 (HDAC1)
   05203 Viral carcinogenesis
    100070281 (HDAC1)
   05220 Chronic myeloid leukemia
    100070281 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    100070281 (HDAC1)
  Substance dependence
   05034 Alcoholism
    100070281 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100070281 (HDAC1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100070281 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 508 aa AA seqDB search
MEIPEETRKRLYQGVCCKIPGFCFCWEYVSNCVTETVTLSSSGDVGNYYYGQGHPMKPHR
IRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRF
NVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVN
DIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDI
GAGKGKYYAVNYPLRDGIDDESYEAIFKPVISKVMEMFQPSAVVLQCGSDSLSGDRLGCF
NLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETSVALDTEIPNELPYNDYF
EYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESG
DEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKEPE
EKKEVTEEEKTKEEKQEAKGVKEEVKLA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggagattcctgaggagaccagaaagagactttaccaaggcgtttgttgtaaaattcct
gggttctgcttctgctgggagtatgtgtctaactgtgtcactgaaactgtcactctttct
tcttcaggggatgttggaaattactattatggacaaggccacccaatgaagcctcaccga
atccgtatgacccacaatttgctacttaactatggtctctaccgaaaaatggaaatctat
cgccctcacaaagccaatgctgaggagatgaccaagtaccacagtgatgactacattaaa
ttcttgcgttccatccgcccagataacatgtctgagtacagcaagcagatgcagagattc
aacgttggtgaggactgtccggtatttgatggcctgtttgagttctgtcagttatctact
ggtggctctgtggcaagtgctgtgaaacttaataagcagcagacggacatcgctgtgaat
tgggctgggggcctgcaccatgcaaagaagtccgaggcatctggcttctgttacgtcaat
gatatcgtcttggccatcctggaactgctaaagtatcaccagagggtgctgtatattgac
attgatattcaccacggcgatggcgtggaagaggccttctataccacagaccgggtcatg
actgtgtcctttcataaatacggagagtacttcccaggaactggggacctacgggatatt
ggggctggcaaaggcaagtattatgctgttaactacccgctccgagatgggattgatgac
gagtcctatgaggccattttcaagccggtcatatccaaggtaatggagatgttccagccc
agtgcagtcgtcttacagtgtggctctgactccctgtccggggatcggttaggttgcttc
aatctgaccatcaaagggcacgccaagtgtgtggaatttgtgaagagcttcaacctgcct
atgctgatgctgggaggcggtggctacaccattcgtaatgttgcccggtgctggacatat
gaaacgtctgtggccctggacacagagatccctaatgagcttccatacaacgactacttt
gaatactttggaccagatttcaaacttcacatcagtccttccaatatgactaaccagaac
actaatgagtacctggagaagatcaaacagcgactgtttgagaacctgagaatgctgccc
catgcacctggggtccaaatgcaggcgattcctgaggatgccattccagaggagagtggc
gatgaggacgaagaagaccctgacaagcgcatctcaatctgttcctctgacaaacgaatt
gcctgtgaggaagagttctctgactctgatgaggagggagaaggcggtcgcaagaattct
tccaacttcaaaaaagccaagagagtcaaaacagaggatgaaaaagagaaagagccagaa
gaaaagaaagaagtcacagaagaggagaaaaccaaggaggagaagcaagaagccaaaggg
gtcaaggaggaggtcaagttggcctga

DBGET integrated database retrieval system