KEGG   Equus caballus (horse): 100070281Help
Entry
100070281         CDS       T01058                                 

Gene name
HDAC1
Definition
histone deacetylase 1
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ecb  Equus caballus (horse)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:ecb04330]
Cellular Processes; Cell growth and death; Cell cycle [PATH:ecb04110]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:ecb04919]
Human Diseases; Cancers; Pathways in cancer [PATH:ecb05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:ecb05202]
Human Diseases; Cancers; Viral carcinogenesis [PATH:ecb05203]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:ecb05220]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:ecb05016]
Human Diseases; Substance dependence; Alcoholism [PATH:ecb05034]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:ecb05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 508 aa AA seqDB search
MEIPEETRKRLYQGVCCKIPGFCFCWEYVSNCVTETVTLSSSGDVGNYYYGQGHPMKPHR
IRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRF
NVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVN
DIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDI
GAGKGKYYAVNYPLRDGIDDESYEAIFKPVISKVMEMFQPSAVVLQCGSDSLSGDRLGCF
NLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETSVALDTEIPNELPYNDYF
EYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESG
DEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKEPE
EKKEVTEEEKTKEEKQEAKGVKEEVKLA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggagattcctgaggagaccagaaagagactttaccaaggcgtttgttgtaaaattcct
gggttctgcttctgctgggagtatgtgtctaactgtgtcactgaaactgtcactctttct
tcttcaggggatgttggaaattactattatggacaaggccacccaatgaagcctcaccga
atccgtatgacccacaatttgctacttaactatggtctctaccgaaaaatggaaatctat
cgccctcacaaagccaatgctgaggagatgaccaagtaccacagtgatgactacattaaa
ttcttgcgttccatccgcccagataacatgtctgagtacagcaagcagatgcagagattc
aacgttggtgaggactgtccggtatttgatggcctgtttgagttctgtcagttatctact
ggtggctctgtggcaagtgctgtgaaacttaataagcagcagacggacatcgctgtgaat
tgggctgggggcctgcaccatgcaaagaagtccgaggcatctggcttctgttacgtcaat
gatatcgtcttggccatcctggaactgctaaagtatcaccagagggtgctgtatattgac
attgatattcaccacggcgatggcgtggaagaggccttctataccacagaccgggtcatg
actgtgtcctttcataaatacggagagtacttcccaggaactggggacctacgggatatt
ggggctggcaaaggcaagtattatgctgttaactacccgctccgagatgggattgatgac
gagtcctatgaggccattttcaagccggtcatatccaaggtaatggagatgttccagccc
agtgcagtcgtcttacagtgtggctctgactccctgtccggggatcggttaggttgcttc
aatctgaccatcaaagggcacgccaagtgtgtggaatttgtgaagagcttcaacctgcct
atgctgatgctgggaggcggtggctacaccattcgtaatgttgcccggtgctggacatat
gaaacgtctgtggccctggacacagagatccctaatgagcttccatacaacgactacttt
gaatactttggaccagatttcaaacttcacatcagtccttccaatatgactaaccagaac
actaatgagtacctggagaagatcaaacagcgactgtttgagaacctgagaatgctgccc
catgcacctggggtccaaatgcaggcgattcctgaggatgccattccagaggagagtggc
gatgaggacgaagaagaccctgacaagcgcatctcaatctgttcctctgacaaacgaatt
gcctgtgaggaagagttctctgactctgatgaggagggagaaggcggtcgcaagaattct
tccaacttcaaaaaagccaagagagtcaaaacagaggatgaaaaagagaaagagccagaa
gaaaagaaagaagtcacagaagaggagaaaaccaaggaggagaagcaagaagccaaaggg
gtcaaggaggaggtcaagttggcctga

DBGET integrated database retrieval system