KEGG   Equus caballus (horse): 100070397Help
Entry
100070397         CDS       T01058                                 

Gene name
USP1
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 1 isoform X1
  KO
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    100070397 (USP1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100070397 (USP1)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100070397 (USP1)
Ubiquitin system [BR:ecb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100070397 (USP1)
DNA repair and recombination proteins [BR:ecb03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     100070397 (USP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
5
AA seq 793 aa AA seqDB search
MPGVTPSESSGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSPENEEKAECRGSEIDQVV
PAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKE
ALKDEANQRDKGNCKEDSLTSYELICSLQSLIISVEQLQANFLLNPEKYTDELATQPRRL
LNTLRIHEMGIFIYRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKEEEVKNVAELST
KVEEKPHQKGERSGINSVEMDSMRHSEDHKEKLPKGNGKRKSDTEFGNMKKKVKVSKEHQ
SLEENQRQTRSKRKATGDMLEIPPKIIPKYISEGESARPSQKKSRVKVNWLKPATKQPSI
LSKFCSLGKITTHQGSKEQSKESEYLEEDLGKGENDDTTNGCGLESPGNDVKSINVNEVK
PINTGAEQIGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESS
EISPEPKTEMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHL
KCFAASGLEFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSG
HYTASVKVTDLNSLELDKGNFVVDQMCEIGKPEPSNEEEARGVVENYADEDVSIRVGANT
QPSKVLNKKNVEAIGLLGGQKSKADYELYNKASNPDKGASTAFAENRSSETNSSNGTHES
DRNKESSDQTGINISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTS
PTSTPYLLFYKKL
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtgtcacaccgagcgaaagcagcggactttccagaggaagtccgtccaagaaa
aacagactttccttgaagttttttcagaaaaaggaaactaagagagccttggatttcaca
gattctccagaaaacgaagaaaaagccgagtgtcgaggctctgaaattgatcaagttgtt
ccggcagcacagtcctcacctataaactgtgagaagagggagaacttgttaccatttgtg
ggactgaataatctcggcaatacttgttatcttaatagtatacttcaggtattatatttt
tgtccgggttttaaatctggagtgaagcacttatttaatattatttcaaggaagaaagaa
gccctaaaagatgaagccaatcaaagagataagggaaattgcaaagaagattctttgaca
agttatgaactaatatgcagtttacagtccttgatcatttcagttgaacagcttcaggct
aattttctcttaaatccagagaaatacactgatgaacttgctactcagccaaggcgactg
cttaacacactcagaatacatgaaatgggaatttttatttatagggaactcaaccctatg
tatgaaggatatctacagcatgatgcacaggaagtattacagtgtattttgggaaacatt
caagaaacatgccaacttctaaaagaagaagaagtaaaaaatgtggcagaattatctact
aaggtagaggaaaaacctcatcagaaaggggaaaggagtggtattaacagcgtagagatg
gacagcatgaggcattctgaagaccataaagaaaaactcccaaaagggaatgggaaaaga
aaaagtgacactgaatttggcaacatgaagaaaaaagttaaagtatccaaggaacaccag
tcattagaagaaaaccagagacaaaccagatcaaaaagaaaagctacaggtgatatgtta
gagattcctcctaaaataatccccaagtacatttctgaaggtgagagtgcaagaccctca
caaaagaaatccagagttaaagtaaattggttaaagcctgcaactaagcaacctagcatt
ctttctaaattctgtagtctgggaaaaataacaacacaccaaggatccaaagaacaatct
aaagaaagtgaatatcttgaagaggacttggggaagggtgaaaatgatgacacaactaat
ggttgtggacttgaatctccagggaacgatgttaaatccattaatgttaatgaagttaag
cccataaacacaggtgcagagcagattggttttgagctagtagagaaattatttcaaggt
cagctggtattaaggactcgttgcttagaatgtgaaagtttaacagaaagaagagaagat
tttcaagacatcagtgtaccagtgcaagaagatgagctttccaaagtagaggagagttct
gaaatttctccagagccaaaaacagaaatgaagactctgagatgggcaatttcacaattt
gcttcagtggagagaattgtaggagaagataaatatttctgtgaaaattgccatcattat
actgaagccgaacgaagtcttttgtttgacaaaatgcctgaagttataactattcatttg
aagtgctttgctgctagtggcttagagtttgactgttatggtggtggactttccaagatc
aacactcccttactgacacctcttaaattgtcactagaagaatggagcacaaagccaacc
aacgatagctatggattatttgctgttgtgatgcatagcggcattacaattagtagcggg
cattacactgcttctgttaaagtcactgaccttaacagtttagaactggataagggaaat
tttgtagtggaccaaatgtgtgaaataggtaaaccagaaccatcaaatgaggaggaagca
aggggtgtggtggaaaattacgctgatgaagatgtctcgattagagttggtgcaaataca
cagccaagtaaagttttgaacaaaaaaaatgtagaagctattggacttcttggaggacaa
aagagcaaagcagattatgagctatacaacaaagcgtctaatcctgataaaggtgccagt
acagcatttgctgaaaacagaagttctgagactaacagttctaatgggacccatgaatct
gatagaaacaaggaatccagtgaccaaacaggcattaacattagtggatttgagaacaaa
atttcatatgtagtgcaaagcttaaaggagtatgaggggaagtggttgctttttgatgat
tctgaagtgaaagtcactgaagagaaggactttttgaattctctttccccttctacatct
cctacatccacgccttacttgctattttataagaaattatag

DBGET integrated database retrieval system