KEGG   Equus caballus (horse): 100070545Help
Entry
100070545         CDS       T01058                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X3
  KO
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
EGFR tyrosine kinase inhibitor resistance
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
Phospholipase D signaling pathway
Axon guidance
VEGF signaling pathway
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Thyroid hormone signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Kaposi's sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Hepatocellular carcinoma
Choline metabolism in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100070545 (PLCG1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100070545 (PLCG1)
   04015 Rap1 signaling pathway
    100070545 (PLCG1)
   04012 ErbB signaling pathway
    100070545 (PLCG1)
   04370 VEGF signaling pathway
    100070545 (PLCG1)
   04064 NF-kappa B signaling pathway
    100070545 (PLCG1)
   04066 HIF-1 signaling pathway
    100070545 (PLCG1)
   04020 Calcium signaling pathway
    100070545 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100070545 (PLCG1)
   04072 Phospholipase D signaling pathway
    100070545 (PLCG1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100070545 (PLCG1)
   04660 T cell receptor signaling pathway
    100070545 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    100070545 (PLCG1)
   04659 Th17 cell differentiation
    100070545 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    100070545 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    100070545 (PLCG1)
   04670 Leukocyte transendothelial migration
    100070545 (PLCG1)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100070545 (PLCG1)
  Nervous system
   04722 Neurotrophin signaling pathway
    100070545 (PLCG1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100070545 (PLCG1)
  Development
   04360 Axon guidance
    100070545 (PLCG1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100070545 (PLCG1)
   05231 Choline metabolism in cancer
    100070545 (PLCG1)
   05206 MicroRNAs in cancer
    100070545 (PLCG1)
   05205 Proteoglycans in cancer
    100070545 (PLCG1)
   05225 Hepatocellular carcinoma
    100070545 (PLCG1)
   05214 Glioma
    100070545 (PLCG1)
   05223 Non-small cell lung cancer
    100070545 (PLCG1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100070545 (PLCG1)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100070545 (PLCG1)
   05169 Epstein-Barr virus infection
    100070545 (PLCG1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100070545 (PLCG1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100070545 (PLCG1)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100070545 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100070545 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
22
AA seq 1160 aa AA seqDB search
MWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNMLSQVNYRVPNM
RFLRERLTDLEQRSSDITYGQFAQLYRSLMYSAQKTMDLPFLEASALRAGERPELCRVSL
PEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVTFLFSKENSVWN
SQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDG
PDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQYFKK
VLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVMYSENDISNSIK
NGILYLEDPVNHEWYPHYFVLTSSKIYYSEETNSDQGNEDEEEPKETSGSTELHSNEKWF
HGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIH
SRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHA
SLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEF
DSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPT
FKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVS
PAALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSISMASMAHWSLDV
AADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYCRPVPFDEEKIG
TERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWIC
GSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKSSLRGLEPCAIC
IEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVWPAKPFHFQISN
PEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDLELASLLVKIDV
FPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFEARYQQPFEDFRISQEHLADH
FDSRERRAPRRTRVNGDNRL
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atgtggatcaagggcttaacttggttgatggaggatactttgcaggcggccacacccctg
cagattgagaggtggctgcggaagcagttctactcagtggatcgaaaccgtgaggaccgt
atatcagccaaggacctgaagaacatgctgtcccaggtcaactaccgggtccccaacatg
cgcttccttcgagagcggctaacggacctggagcagcgcagcagcgacatcacctatggg
cagtttgctcagctgtaccgcagcctcatgtacagcgcccagaagacgatggacctccct
ttcttggaagccagtgccctgagggctggggagcggccagagctctgccgagtgtcactt
cctgagttccagcagtttctcctcgagtaccagggggagctgtgggctgttgaccggctc
caggtgcaggagtttatgctcagcttcctcagagaccccttgcgagagattgaggagcca
tacttcttcctggacgagttcgtcaccttcctattctccaaagagaacagtgtgtggaac
tcacagctggatgcagtgtgcccagacaccatgaacaaccctctctctcactactggatc
tcctcctcgcacaatacgtatctgaccggggaccagttctccagcgagtcctccctggaa
gcctatgctcgctgcctgcggatgggctgtcgctgcattgagttggactgttgggacggc
ccagacgggatgcctgtcatttaccacggacacacccttaccaccaagatcaagttctca
gatgtcctgcacaccatcaaggagcatgcctttgtggcctcagagtacccggtcatcctg
tccatcgaggaccactgcagtattgcccagcaaaggaacatggcccagtacttcaagaag
gtgctcggggacacactcctcaccaagcctgtggacatcgccgcagatgggctgccttca
cccaatcagctcaagaggaagatccttatcaagcacaagaagctggctgagggtagtgcc
tatgaggaggtgcctacatctgtgatgtactcagagaacgacatcagcaactccatcaag
aatggcatcctctacctggaggaccctgtgaaccatgagtggtatccccactactttgtt
ctgaccagcagcaagatctactactctgaggagaccaacagtgaccagggcaatgaggat
gaggaggagcccaaggagaccagcggcagcacagagctgcactccaacgagaagtggttc
catgggaagctcggggcaggacgggacgggcggcacatcgccgagcgcctgctcaccgag
tactgcattgagaccggggcccccgatggctccttcctagtgcgcgagagcgagaccttt
gtgggcgactacaccctctctttctggcggaacgggaaagtccagcactgcaggatccac
tctcggcaggatgctgggacccccaagttcttcttaacagacaacctcgtctttgactcc
ctctatgacctcatcacacactaccagcaggtgcccctgcgctgcaacgaatttgagatg
cgcctctcagagcctgtcccacagaccaatgcccacgagagcaaagagtggtaccacgca
agcctgaccagagcacaggctgagcacatgctgatgcgtgtcccccgtgatggtgcattc
ctggtgcggaaacggaatgagcccaactcttacgccatatccttccgggccgagggcaag
attaagcattgccgtgtccagcaggagggccagactgtgatgctgggcaactcggagttt
gacagcctcgttgacctcatcagctactatgagaagcatccgctgtaccgcaagatgaaa
ctgcgctatcccatcaacgaggaggcgctggagaagattggcacagctgagcctgactac
ggggccctgtatgagggacgcaaccctggcttctatgtggaagcaaaccctatgccgact
ttcaagtgtgcagttaaagccctctttgactacaaggcccagagagaggatgagctgact
ttcaccaagagcgccatcatccagaatgtggagaagcaagagggaggctggtggcgaggg
gactatggtgggaagaagcagctgtggttcccatccaactacgtggaagaaatggtcagt
ccagcggccctggagcctgaaagggagcacttggacgagaacagccctctgggggacttg
ctgcggggggtcttggatgtgccagcttgtcagattgccatccgtcctgagggcaagaac
aaccggctcttcgtcttctccatcagcatggcgtccatggcacactggtccctggatgtt
gctgctgactctcaggaggagctgcaggactgggtgaaaaagatccgagaagtggcccag
accgcagatgccaggctcactgaggggaagatgatggaacggaggaagaagattgccctg
gagctctccgagcttgttgtctactgccgacctgttccttttgatgaagagaagattggc
acagaacgtgcctgctaccgggacatgtcatcctttccggaaaccaaggctgagaaatat
gtgaacaaggccaaaggcaagaagttcctccagtacaaccggctccagctctcccgcatc
taccccaagggccagcggctggactcctccaattacgatcccttgcccatgtggatctgt
ggcagtcagctggtggccctcaacttccagaccccagacaagcctatgcagatgaaccag
gccctcttcatggccggcgggcactgtggctacgtgctgcagccaagcaccatgcgggac
gaggccttcgacccctttgacaagagcagcctccgtgggctagagccatgcgccatctgc
atcgaggtgctgggggcccggcatctgccaaagaatggccgaggcattgtgtgtcctttt
gtggagattgaggtggctggagctgagtatgacagcaccaagcagaagacagagtttgtg
gtggacaatggactgaaccccgtgtggccagccaagcccttccacttccagatcagtaac
cccgaattcgccttcctgcgctttgtagtgtatgaggaagacatgtttagtgaccagaac
ttcctggcccaggctactttcccggtgaaaggcctgaagacaggatatagagcggtgcct
ttgaaaaacaactacagtgaggacctggagctggcctccctgctcgtcaagatcgacgtt
ttccctgccaagcaggagaacggcgacctcagtcccttcagtggtacgtccctgcgggaa
cggggctctgatgcctcgggccagctgtttcatggccgggcccgggaaggctcctttgaa
gcccgctaccagcagccatttgaggactttcgcatctcccaggagcaccttgcagaccat
tttgacagtcgggaacgaagggccccacgaaggactcgggtcaacggagacaatcgcctc
tag

DBGET integrated database retrieval system