KEGG   Equus caballus (horse): 100070638Help
Entry
100070638         CDS       T01058                                 

Definition
uncharacterized LOC100070638
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ecb  Equus caballus (horse)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ecb03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 509 aa AA seqDB search
MSWPHGAHSTGKSSSTGVLFDPFVTNSRQTSQKPTPSTLAGKTAGKAALSARSFPGAPRT
PASPGISPPPARDCALRGSGRPVHRPHRRAWRSKPASERGVGEPGGLLGIHKRPRAAIKV
IRGRAHPSRRGWGWQARVARTGEAQALGKGTARLTSPHSRFPPRGTRLGLAISWPLISPR
PNNPQNLSRVGEELNGWGSPPGPSQGSGPGTGSVASVFLGERGGPGPSPSWRVRVPGCIP
PTSWRQEVTAAAGPVHVQTSLSGVARRDETGKLGIEPHGSSHMESLATHLLFRAEVSPGP
DNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLT
PEEQLADKLRLKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQ
YEKSLYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPG
GGLKATMKDDLADYGGYDGGYVQDYEDFM
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggcctcatggggctcacagcacaggaaaatcctcgagcactggggttctcttc
gatcccttcgtgactaactcgaggcaaacgtcccagaagccgactccaagcaccctggct
gggaagactgccgggaaggcggccctctccgctcgctccttcccgggcgccccgcgcacg
ccggcttccccaggcatctctcctcccccagcgcgtgactgcgccctccgggggtcgggg
aggccggtccaccgcccccacagacgggcgtggcgctcaaagccagcttctgagcgtggc
gtgggagagcctgggggtctccttggtatccacaagcggccacgggcggcgatcaaagtg
atcagaggaagggcgcacccgagcaggcggggctggggttggcaggcgagggtggcgaga
acgggcgaagcccaagcgctaggcaagggaactgcgcggctaacttccccgcactcacgt
tttcctccccgaggaaccaggcttgggttggcgatctcctggccgcttatctctccccgg
cccaacaatcctcagaacctctcccgcgtcggtgaggaactgaacggctgggggtcgccc
cccggcccttcccaaggctcgggcccggggacgggcagcgtggcctcggtcttccttggc
gagcgcggcggcccgggccctagcccttcttggagggtccgcgtcccgggctgcattcca
cccaccagctggcgacaggaggtgacagcagcggccgggccggtccacgtgcaaacttcg
ctgtccggagtcgctcgccgggatgagacggggaagttggggattgaaccgcatggctcg
tcccatatggaaagtcttgcaacccacctgctttttcgagctgaggtctccccagggccg
gataactgggatgatgatgatgacgaaaaaaaagaggaagcagaagtaaaaccagaagta
aaaatttcagaaaagaaaaaaatagcagagaagataaaagagaaagaacgacaacagaag
aaaaggcaagaagaaattaaaaagaggttagaagaacctgaagaacctaaagtgttaaca
ccagaagaacaattagcagataaactccggctaaagaaattacaggaagagtcagacctc
gaattagcaaaagaaacttttggtgttaataatacagtttatggaatagatgctatgaac
ccatcttcaagagatgacttcacagagtttggaaagttgttaaaagataaaattacacaa
tatgaaaagtcactatattatgccagttttttggaagccttagttcgagatgtgtgtatt
tcattggaaattgatgacttgaaaaagattaccaattcattgactgtgctttgcagtgaa
aaacagaagcaagaaaagcaaagcaaagccaaaaagaagaagaaaggtgtggttcctgga
gggggattaaaggccaccatgaaagatgatctggcagattatggtggttatgatggagga
tatgtacaagactatgaagacttcatgtga

DBGET integrated database retrieval system