KEGG   Equus caballus (horse): 100070638Help
Entry
100070638         CDS       T01058                                 

Gene name
EIF3J
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit J isoform X1
  KO
K03245  translation initiation factor 3 subunit J
Organism
ecb  Equus caballus (horse)
Pathway
ecb03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100070638 (EIF3J)
Ribosome biogenesis [BR:ecb03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    100070638 (EIF3J)
Translation factors [BR:ecb03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100070638 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit DUF5093
Motif
Other DBs
NCBI-GeneID: 100070638
NCBI-ProteinID: XP_023474313
Position
1
AA seq 326 aa AA seqDB search
MCIERKRLILRIWFAGLWDLASPKAAGQASRLETQGRADAAESKGSLERSPVAQRAECSL
AHRKPYIMVSLPAPFIWIGPLSDADTFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNW
DDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEE
QLADKLRLKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEK
SLYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGL
KATMKDDLADYGGYDGGYVQDYEDFM
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtgtatagagagaaagagacttattttaaggatttggtttgcaggattgtgggatctg
gcaagtccaaaagctgcagggcaggccagcaggctggagacccagggaagagctgatgct
gcagagtccaaaggcagtctggagcgcagcccagtggcccaaagggcagagtgcagctta
gcccatcgtaagccctacattatggtcagtttacctgctccgtttatctggattgggcca
ctctcagacgcggacacgttctccgtggaagacccggtgcggaaggtggggggcggcggc
accgccggcggggatcgctgggaaggcgaggacgaggacgaggacgtcaaggataactgg
gatgatgatgatgacgaaaaaaaagaggaagcagaagtaaaaccagaagtaaaaatttca
gaaaagaaaaaaatagcagagaagataaaagagaaagaacgacaacagaagaaaaggcaa
gaagaaattaaaaagaggttagaagaacctgaagaacctaaagtgttaacaccagaagaa
caattagcagataaactccggctaaagaaattacaggaagagtcagacctcgaattagca
aaagaaacttttggtgttaataatacagtttatggaatagatgctatgaacccatcttca
agagatgacttcacagagtttggaaagttgttaaaagataaaattacacaatatgaaaag
tcactatattatgccagttttttggaagccttagttcgagatgtgtgtatttcattggaa
attgatgacttgaaaaagattaccaattcattgactgtgctttgcagtgaaaaacagaag
caagaaaagcaaagcaaagccaaaaagaagaagaaaggtgtggttcctggagggggatta
aaggccaccatgaaagatgatctggcagattatggtggttatgatggaggatatgtacaa
gactatgaagacttcatgtga

DBGET integrated database retrieval system