KEGG   Equus caballus (horse): 100070738Help
Entry
100070738         CDS       T01058                                 

Gene name
PGAM1
Definition
phosphoglycerate mutase 1 (brain)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ecb  Equus caballus (horse)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100070738 (PGAM1)
   01230 Biosynthesis of amino acids
    100070738 (PGAM1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100070738 (PGAM1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100070738 (PGAM1)
Enzymes [BR:ecb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100070738 (PGAM1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100070738 (PGAM1)
  Exosomal proteins of melanoma cells
   100070738 (PGAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 234 aa AA seqDB search
MGNLYVRKFWLQSRPDQLITLNLQFPDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLP
VVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR
RYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGL
SEEAIMELNLPTGIPMVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatttatatgtaagaaaattctggctccagagtagacctgatcaacttatcact
ttgaacttacaatttccagatgctggctatgagtttgacatctgcttcacctcagtgcag
aagagagcaattcggaccctctggacagtgctggatgccattgaccaaatgtggctgcca
gtagtgaggacttggcgcctcaatgagcggcactatggaggtctgactggcctcaataaa
gcagaaactgctgccaagcatggcgaggcccaggttaagatctggaggcgctcctatgat
gttccaccacctccgatggagcccgaccatcccttctacagcaacatcagtaaggatcgc
aggtatgcagacctcactgaagatcagctaccctcctgtgagagtctgaaggacactatt
gccagagctctgcccttttggaatgaagaaatagttccccagatcaaggaggggaaacgg
gtattgattgctgcccatggcaacagcctccggggcatcgtcaagcatctggagggtctc
tctgaagaggctatcatggagctgaacctgccaactggtattcccatggtctatgaattg
gacaagaacttgaagcccatcaagcccatgcagttcctgggggatgaagagaccgtgcgt
aaagccatggaagctgtggctgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system