KEGG   Equus caballus (horse): 100070738Help
Entry
100070738         CDS       T01058                                 

Gene name
PGAM1
Definition
phosphoglycerate mutase 1 (brain)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ecb  Equus caballus (horse)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100070738 (PGAM1)
   01230 Biosynthesis of amino acids
    100070738 (PGAM1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100070738 (PGAM1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100070738 (PGAM1)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    100070738 (PGAM1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100070738 (PGAM1)
Enzymes [BR:ecb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100070738 (PGAM1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100070738 (PGAM1)
  Exosomal proteins of melanoma cells
   100070738 (PGAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 234 aa AA seqDB search
MGNLYVRKFWLQSRPDQLITLNLQFPDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLP
VVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR
RYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGL
SEEAIMELNLPTGIPMVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatttatatgtaagaaaattctggctccagagtagacctgatcaacttatcact
ttgaacttacaatttccagatgctggctatgagtttgacatctgcttcacctcagtgcag
aagagagcaattcggaccctctggacagtgctggatgccattgaccaaatgtggctgcca
gtagtgaggacttggcgcctcaatgagcggcactatggaggtctgactggcctcaataaa
gcagaaactgctgccaagcatggcgaggcccaggttaagatctggaggcgctcctatgat
gttccaccacctccgatggagcccgaccatcccttctacagcaacatcagtaaggatcgc
aggtatgcagacctcactgaagatcagctaccctcctgtgagagtctgaaggacactatt
gccagagctctgcccttttggaatgaagaaatagttccccagatcaaggaggggaaacgg
gtattgattgctgcccatggcaacagcctccggggcatcgtcaagcatctggagggtctc
tctgaagaggctatcatggagctgaacctgccaactggtattcccatggtctatgaattg
gacaagaacttgaagcccatcaagcccatgcagttcctgggggatgaagagaccgtgcgt
aaagccatggaagctgtggctgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system