KEGG   Equus caballus (horse): 100070738Help
Entry
100070738         CDS       T01058                                 

Gene name
PGAM1
Definition
(RefSeq) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00010  Glycolysis / Gluconeogenesis
ecb00260  Glycine, serine and threonine metabolism
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
ecb01230  Biosynthesis of amino acids
ecb04922  Glucagon signaling pathway
ecb05230  Central carbon metabolism in cancer
Module
ecb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecb_M00002  Glycolysis, core module involving three-carbon compounds
ecb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100070738 (PGAM1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100070738 (PGAM1)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    100070738 (PGAM1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100070738 (PGAM1)
Enzymes [BR:ecb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100070738 (PGAM1)
Membrane trafficking [BR:ecb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100070738 (PGAM1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100070738 (PGAM1)
  Exosomal proteins of melanoma cells
   100070738 (PGAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 100070738
NCBI-ProteinID: XP_023497317
Ensembl: ENSECAG00000010786
Position
1
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPMVYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctataagctggtgctgatccggcacggcgaaagcgcgtggaacctggagaac
cgcttcagcggctggtacgacgccgacctgagcccggcggggcacgaggaggcgaagcgc
ggcgggcaggcactgcgagatgctggctatgagtttgacatctgcttcacctcagtgcag
aagagagcaattcggaccctctggacagtgctggatgccattgaccaaatgtggctgcca
gtagtgaggacttggcgcctcaatgagcggcactatggaggtctgactggcctcaataaa
gcagaaactgctgccaagcatggcgaggcccaggttaagatctggaggcgctcctatgat
gttccaccacctccgatggagcccgaccatcccttctacagcaacatcagtaaggatcgc
aggtatgcagacctcactgaagatcagctaccctcctgtgagagtctgaaggacactatt
gccagagctctgcccttttggaatgaagaaatagttccccagatcaaggaggggaaacgg
gtattgattgctgcccatggcaacagcctccggggcatcgtcaagcatctggagggtctc
tctgaagaggctatcatggagctgaacctgccaactggtattcccatggtctatgaattg
gacaagaacttgaagcccatcaagcccatgcagttcctgggggatgaagagaccgtgcgt
aaagccatggaagctgtggctgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system