KEGG   Equus caballus (horse): 100070818Help
Entry
100070818         CDS       T01058                                 

Gene name
PFKP
Definition
phosphofructokinase, platelet
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ecb  Equus caballus (horse)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
AMPK signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100070818 (PFKP)
   01230 Biosynthesis of amino acids
    100070818 (PFKP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100070818 (PFKP)
   00030 Pentose phosphate pathway
    100070818 (PFKP)
   00051 Fructose and mannose metabolism
    100070818 (PFKP)
   00052 Galactose metabolism
    100070818 (PFKP)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100070818 (PFKP)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100070818 (PFKP)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100070818 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
29
AA seq 752 aa AA seqDB search
MNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARC
KAFRSREGRLQAARNLVQLGITNLCVIGGDGSLTGANIFRKEWSGLLEELAQNGQINKEE
VEKYSYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVIDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFLPESPPEEGWQENMCVKLSENRARKKRLNIIIVAEGAIDT
QNKPITSEQIKELVVTQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATP
ETPACVVSLSGNQAVRLPLVKCVQMTQDVQKAMDERRFKDAVQLRGRSFENNLNTYKRLA
IKMPDTQIPKSNCNVGVINVGAPAAGMNAAVRAAVRVGIADGHKMFAVYDGFEGFAKGQI
KEIGWGDVGGWTGQGGSILGTKRTLPGKYLTEIAGQMRTHSINALLIIGGFEAYLGLLEL
SAAREKHEEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVF
IIETMGGYCGYLANMGGLAAGADAAYIFEEPFDIRDLQANVEHLTEKMKTTIQRGLVLRN
ESCSENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKMSARAMQWIT
TKLKESQGKGRRFVSDDSICVLGISKRNLVFRPVAELKKETDFEHRIPKEQWWLKLRPLM
KILAKYKASFEVSDSEELEHVHHRGHEEPAAI
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgctgtccgtgctgtcgtgcgcatggggatatacgtgggggccaaggtgtac
tttatctatgagggttaccagggcatggtggatggcggcagcaacatcgtggaagccgac
tgggagagcgtctcgagcatcctgcaagtgggtgggaccattatcggcagcgcccgttgc
aaggccttccgctcacgggagggccgcctgcaggctgctcggaacttggtccagctgggt
atcaccaacctgtgtgtgatcggcggggatggcagtctcactggggccaacatcttccgg
aaggagtggagcgggctgctggaagagctggcccagaatggccagatcaacaaagaggag
gtggagaagtactcgtacctcaacgtcgtggggatggtgggctccatcgacaacgacttc
tgcgggacggacatgaccatcggcaccgactcagctttgcacaggatcattgaggtcatc
gacgccatcatgaccaccgcccagagccaccagaggacgttcgttcttgaggtgatgggg
agacactgcgggtacctagccctggtgagcgccttggcctgcggggccgactgggtgttc
ctgcccgagtctccgccggaagagggctggcaggaaaacatgtgtgtcaaactctcggag
aaccgtgcccggaagaagagactgaatatcatcattgtggccgaaggagccatcgatacc
caaaataaacccatcacctcggaacaaatcaaggagctcgtggtcacgcagctgggatat
gacacgcgggtgaccatcctgggtcacgtgcagagaggagggacgccgtctgccttcgac
aggattttggccagccgcatgggcgtggaggccgtggtcgcccttctccaggccacccca
gagaccccggcctgcgtggtgtcgctgagcgggaaccaggccgtgcgcctgcccctggtg
aagtgcgtgcagatgacccaggatgtgcagaaggcgatggatgagaggaggtttaaggat
gctgtgcagctccgaggaaggagcttcgagaacaacctgaacacctacaagcggcttgcc
atcaagatgccggacacccagatcccaaagagcaactgtaacgtgggtgtcataaacgtg
ggcgcgccagccgccggcatgaacgccgccgtgcgcgcggccgtgcgggtgggcatcgcc
gacggccacaagatgttcgccgtctatgatggctttgaaggctttgccaaaggccagatc
aaagaaatcggctggggagatgtcggaggttggaccggccaaggaggctccattcttgga
acaaaacgcaccctccctgggaagtacctgacggagattgccgggcagatgcgcacccac
agcatcaatgcgttattgatcattggtgggtttgaggcctacttgggactgctggaactg
tcagctgcccgggagaagcacgaagagttctgtgtccccatggtcatggtccccgccacc
gtctccaacaacgtgcctggctccgatttcagcatcggtgcagacaccgccctgaacact
atcaccgacacatgtgaccgcatcaaacagtcggccagcgggaccaagcgccgcgtgttc
atcatcgagaccatggggggctattgcggctacctggccaacatgggggggcttgctgca
ggagccgacgccgcctacatttttgaggagccctttgacatccgagacctgcaggccaac
gtggagcacctgacggagaagatgaagaccaccatccagaggggactggtgctcaggaac
gagagctgcagcgagaactacaccaccgacttcatctaccagctctactcggaagagggc
aaaggcgtgttcgactgcaggaagaacgtgctgggccacatgcagcaggggggagcgcct
tctcccttcgacagaaactttggaaccaaaatgtctgctagagccatgcaatggatcacc
acgaagctgaaggagtctcagggcaaaggaaggagatttgtaagtgatgattccatctgt
gtgctgggaataagcaaaagaaaccttgttttccgacctgtggcagagctcaagaaggaa
acggacttcgagcacaggattcctaaagagcagtggtggctgaagctgcggcctctcatg
aagatcctggccaagtacaaggccagcttcgaggtgtccgactcggaagagctggagcac
gtgcaccaccgcggccacgaggagccggccgccatctag

DBGET integrated database retrieval system