KEGG   Equus caballus (horse): 100070818Help
Entry
100070818         CDS       T01058                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00010  Glycolysis / Gluconeogenesis
ecb00030  Pentose phosphate pathway
ecb00051  Fructose and mannose metabolism
ecb00052  Galactose metabolism
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
ecb01230  Biosynthesis of amino acids
ecb03018  RNA degradation
ecb04152  AMPK signaling pathway
ecb05230  Central carbon metabolism in cancer
Module
ecb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100070818 (PFKP)
   00030 Pentose phosphate pathway
    100070818 (PFKP)
   00051 Fructose and mannose metabolism
    100070818 (PFKP)
   00052 Galactose metabolism
    100070818 (PFKP)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100070818 (PFKP)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100070818 (PFKP)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100070818 (PFKP)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100070818 (PFKP)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100070818 (PFKP)
Messenger RNA biogenesis [BR:ecb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100070818 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100070818
NCBI-ProteinID: XP_023487978
Ensembl: ENSECAG00000020055
Position
29
AA seq 791 aa AA seqDB search
MDDQDVSANPRGSFRQFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYF
IYEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARCKAFRSREGRLQAARNLVQLGI
TNLCVIGGDGSLTGANIFRKEWSGLLEELAQNGQINKEEVEKYSYLNVVGMVGSIDNDFC
GTDMTIGTDSALHRIIEVIDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFL
PESPPEEGWQENMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEQIKELVVTQLGYD
TRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLSGNQAVRLPLVK
CVQMTQDVQKAMDERRFKDAVQLRGRSFENNLNTYKRLAIKMPDTQIPKSNCNVGVINVG
APAAGMNAAVRAAVRVGIADGHKMFAVYDGFEGFAKGQIKEIGWGDVGGWTGQGGSILGT
KRTLPGKYLTEIAGQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATV
SNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAG
ADAAYIFEEPFDIRDLQANVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGK
GVFDCRKNVLGHMQQGGAPSPFDRNFGTKMSARAMQWITTKLKESQGKGRRFVSDDSICV
LGISKRNLVFRPVAELKKETDFEHRIPKEQWWLKLRPLMKILAKYKASFEVSDSEELEHV
HHRGHEEPAAI
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccaggatgtctccgccaaccccaggggctccttccgacagttcctggagcac
ctctccggggctggcaaagccatcggcgtgctgaccagcggcggggatgcccaaggcatg
aacgccgctgtccgtgctgtcgtgcgcatggggatatacgtgggggccaaggtgtacttt
atctatgagggttaccagggcatggtggatggcggcagcaacatcgtggaagccgactgg
gagagcgtctcgagcatcctgcaagtgggtgggaccattatcggcagcgcccgttgcaag
gccttccgctcacgggagggccgcctgcaggctgctcggaacttggtccagctgggtatc
accaacctgtgtgtgatcggcggggatggcagtctcactggggccaacatcttccggaag
gagtggagcgggctgctggaagagctggcccagaatggccagatcaacaaagaggaggtg
gagaagtactcgtacctcaacgtcgtggggatggtgggctccatcgacaacgacttctgc
gggacggacatgaccatcggcaccgactcagctttgcacaggatcattgaggtcatcgac
gccatcatgaccaccgcccagagccaccagaggacgttcgttcttgaggtgatggggaga
cactgcgggtacctagccctggtgagcgccttggcctgcggggccgactgggtgttcctg
cccgagtctccgccggaagagggctggcaggaaaacatgtgtgtcaaactctcggagaac
cgtgcccggaagaagagactgaatatcatcattgtggccgaaggagccatcgatacccaa
aataaacccatcacctcggaacaaatcaaggagctcgtggtcacgcagctgggatatgac
acgcgggtgaccatcctgggtcacgtgcagagaggagggacgccgtctgccttcgacagg
attttggccagccgcatgggcgtggaggccgtggtcgcccttctccaggccaccccagag
accccggcctgcgtggtgtcgctgagcgggaaccaggccgtgcgcctgcccctggtgaag
tgcgtgcagatgacccaggatgtgcagaaggcgatggatgagaggaggtttaaggatgct
gtgcagctccgaggaaggagcttcgagaacaacctgaacacctacaagcggcttgccatc
aagatgccggacacccagatcccaaagagcaactgtaacgtgggtgtcataaacgtgggc
gcgccagccgccggcatgaacgccgccgtgcgcgcggccgtgcgggtgggcatcgccgac
ggccacaagatgttcgccgtctatgatggctttgaaggctttgccaaaggccagatcaaa
gaaatcggctggggagatgtcggaggttggaccggccaaggaggctccattcttggaaca
aaacgcaccctccctgggaagtacctgacggagattgccgggcagatgcgcacccacagc
atcaatgcgttattgatcattggtgggtttgaggcctacttgggactgctggaactgtca
gctgcccgggagaagcacgaagagttctgtgtccccatggtcatggtccccgccaccgtc
tccaacaacgtgcctggctccgatttcagcatcggtgcagacaccgccctgaacactatc
accgacacatgtgaccgcatcaaacagtcggccagcgggaccaagcgccgcgtgttcatc
atcgagaccatggggggctattgcggctacctggccaacatgggggggcttgctgcagga
gccgacgccgcctacatttttgaggagccctttgacatccgagacctgcaggccaacgtg
gagcacctgacggagaagatgaagaccaccatccagaggggactggtgctcaggaacgag
agctgcagcgagaactacaccaccgacttcatctaccagctctactcggaagagggcaaa
ggcgtgttcgactgcaggaagaacgtgctgggccacatgcagcaggggggagcgccttct
cccttcgacagaaactttggaaccaaaatgtctgctagagccatgcaatggatcaccacg
aagctgaaggagtctcagggcaaaggaaggagatttgtaagtgatgattccatctgtgtg
ctgggaataagcaaaagaaaccttgttttccgacctgtggcagagctcaagaaggaaacg
gacttcgagcacaggattcctaaagagcagtggtggctgaagctgcggcctctcatgaag
atcctggccaagtacaaggccagcttcgaggtgtccgactcggaagagctggagcacgtg
caccaccgcggccacgaggagccggccgccatctag

DBGET integrated database retrieval system