KEGG   Equus caballus (horse): 100070895Help
Entry
100070895         CDS       T01058                                 

Definition
cytochrome P450 2D14-like
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100070895
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100070895
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100070895
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP2 family
   100070895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
28
AA seq 500 aa AA seqDB search
MGLLTWDKLGPVAVAVAIFLLLVDLMHRRQRWAPRYPPGPMPLPGLGNLLQVDFQDTVSS
FTRLRRRFGDVFSLQLAWTPVVVLNGLAAIREALVHRGEDTSDRPRVPVMEHLGFGPHAE
GVVFARYGHTWREQRRFSVSTLRNFGMGKKSLVQWVTQEASYLCAAFADQAGRPFSPNAL
LNKAVSNVIASLTFGRRFEYNDPRFLKLLDLMEDILKEESGFLPQVLNAIPMLLHIPGLV
AKVFPGQRAFMAQLDELVAEHRMTRDPAQPPRDLTDAFLDEVQKSKRNPESSFNDDNLRL
VVTDLFFAGMVTTSTTLAWALLLMILQPDVQRRVQQEIDKVIGQTRRPEMGDQAHMPFTL
AVVHEVQRFGDIIPLGIPHMTSRDIEVQGFLIPKGTTLITNVSSVLKEETIWKKPFRFHP
EHFLDAQGHFVKQEAFMPFSAGRRSCLGEPLARMELFLFFTCLLQRFSFSVPAGQPRPSD
HGCFGSLVTPSPYQLCAEPR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgacctgggataaactggggcctgtggctgtggccgtggccatcttcctg
ctcctggtggacctgatgcaccggcgccaacgctgggccccccgctaccccccaggcccc
atgcccctgcctgggctgggcaacctgctgcaggtggacttccaggacacggtttccagc
tttactcggctgcggcgccgcttcggggacgtgttcagcctgcagctggcctggacgccc
gtggtcgtgctcaacgggctggcggccattcgcgaggcgctggtgcaccgcggcgaggac
acctccgaccgcccacgtgtgccggtgatggagcacctgggtttcgggccgcacgcggaa
ggggtggtctttgcccgctatgggcacacctggcgggagcagcggcgcttctccgtgtcc
accctgcgcaacttcggcatgggcaagaagtccctggtgcagtgggtgacccaggaggcc
tcgtacctctgtgccgccttcgccgaccaggccggaaggccctttagccccaacgccctc
ctgaataaagcggtgagcaacgtgatcgcctccctgaccttcgggcgccgcttcgagtac
aatgacccgcgcttccttaagttattggacctaatggaggacatactgaaggaggagtca
ggcttcctgccccaggtgctgaacgcgatccccatgctcctgcacatcccagggctggtc
gccaaggtctttcctgggcagagggccttcatggcccagctggatgagctagttgctgag
cacaggatgacccgggacccggcccagcctcctcgagacctgactgatgccttcctggac
gaggtgcagaagtccaagaggaaccctgagagcagcttcaatgatgacaacctgcgcctg
gtggtgaccgacctgttctttgccgggatggtgaccacctcgaccacgctggcctgggcc
cttctgctcatgatcctgcaaccggatgttcagcgccgtgtccaacaggagatcgacaag
gtgatagggcagacgcggcgaccagagatgggggaccaggcccacatgcccttcaccttg
gccgtggtccatgaggttcagcgctttggggacatcatcccactgggtataccccacatg
acatcccgtgacattgaagtgcagggcttcctcatccccaaggggaccacactcatcacc
aacgtgtcatcggtgctgaaggaggagaccatctggaagaagcccttccgcttccaccct
gagcacttcctggacgcccagggccacttcgtcaagcaggaggccttcatgcccttctca
gcaggccgccgctcgtgcctcggggagcccctggcccgcatggagctcttcctcttcttc
acctgcctcctgcagcgcttcagcttctcggtgcccgctgggcagccccgccccagcgat
catggttgctttggctccttggtaaccccatcgccttatcagctgtgtgctgagccccgc
tag

DBGET integrated database retrieval system