KEGG   Equus caballus (horse): 100071050Help
Entry
100071050         CDS       T01058                                 

Gene name
CYB5R3
Definition
(RefSeq) NADH-cytochrome b5 reductase 3
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100071050 (CYB5R3)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100071050 (CYB5R3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 100071050
NCBI-ProteinID: XP_001500786
Ensembl: ENSECAG00000008452
Position
28
AA seq 301 aa AA seqDB search
MGAQLSTLGHVVLSPVWFLYSLLMKLFQRSRPAITLENPDIKYPLRLIDKEIVSHDTRRF
RFALPSPQHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPK
FPAGGKMSQYLENMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKCVGMIAG
GTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVD
KAPEAWDYSQGFVNEEMIRDHLPPPEDEPLVLMCGPPPMIQYACLPNLERVGHPKDRCFT
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggggctcagctgagcacgttgggccacgtggtcctctccccggtctggttcctctac
agtctgctcatgaagctgttccagcgctccaggccggccatcaccctcgagaacccggac
atcaagtacccgctgcggctcattgacaaggagatcgtcagccatgacacccggcggttc
cgctttgccctgccgtcgccccagcacatcctgggcctccccgttggccagcacatctac
ctctcggctcgaattgatggaaacctggtcattcggccctacacgcccgtctccagcgat
gatgacaagggcttcgtggacctggtcatcaaggtttacttcaaagacacccatcctaag
tttcccgctggagggaagatgtcccagtacctggaaaacatgaagatcggagacaccatt
gagttccggggcccgaacgggctgctggtctaccagggcaaaggaaagtttgccatccgt
ccagacaagaagtccagccccgtcatcaagacggtgaagtgtgtcggcatgatcgcagga
ggaacgggcatcaccccgatgctgcaggtgatccgcgccatcatgaaggacccggacgac
cacaccgtgtgccacctgctgtttgccaaccagaccgagaaggacatcctgctgcggcct
gagctggaggagctgaggaacgagcattctgcacgcttcaagctctggtacacggtggac
aaagcccctgaagcctgggactacagccagggcttcgtgaacgaggagatgatccgggac
caccttccgcccccggaggacgagccgctggtgctgatgtgtggaccgccacccatgatc
cagtacgcctgcctgcccaacctggagcgcgtgggccaccccaaggatcgctgcttcacc
ttctga

DBGET integrated database retrieval system