KEGG   Equus caballus (horse): 100071076Help
Entry
100071076         CDS       T01058                                 

Gene name
PLB1
Definition
(RefSeq) phospholipase B1, membrane-associated
  KO
K14621  phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00564  Glycerophospholipid metabolism
ecb00565  Ether lipid metabolism
ecb00590  Arachidonic acid metabolism
ecb00591  Linoleic acid metabolism
ecb00592  alpha-Linolenic acid metabolism
ecb01100  Metabolic pathways
ecb04977  Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100071076 (PLB1)
   00565 Ether lipid metabolism
    100071076 (PLB1)
   00590 Arachidonic acid metabolism
    100071076 (PLB1)
   00591 Linoleic acid metabolism
    100071076 (PLB1)
   00592 alpha-Linolenic acid metabolism
    100071076 (PLB1)
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    100071076 (PLB1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100071076 (PLB1)
    3.1.1.5  lysophospholipase
     100071076 (PLB1)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100071076 (PLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL Lipase_GDSL_2
Motif
Other DBs
NCBI-GeneID: 100071076
NCBI-ProteinID: XP_014586721
Ensembl: ENSECAG00000018663
Position
15
AA seq 1466 aa AA seqDB search
MQGPRHLEDSGMGLRPHIFLLGLLLLLGQGTTQAHTSPGENTLEEQLWPETLKNFLLCNP
KKSGSSVPSKSVHSLRPSDIKFVAAIGDVETPPDSGTVDVEKQKWTDKLPQQECLGVVTV
LSDVIRHFSPSVLRPVCAPRERVIPSTGAEDLWIQAKDLVRSMKENQQLDFQNDWKLINV
FFSNASQDHLCPSTQQESRVTSGMDKLTRTLDYLHQEVPKAFVNLVDLSEAMGVSPWHQG
TQLSPAAEPHGCSETSRLSKAVAQWSYQESWERLLASSKYNEQGSFAVVFQPFFYETALL
GEQPLQDPTTLALNLWNNMMEPAGQKDEPFSAKERRPVKCPSEENPYLFTYRNSNYLPMS
PKLHERLEVREGTEIECPDKDPSDSIPTSVHRLKLADIKVIGALGDSLTAANGAGSTPGN
LLDVLTQYRGLSWSCGGDQNLSSVTTLPNILREFNPSLMGFSVGTGNENSPGAFLNQAVA
GATTEGLPAQARRLVDLMKNDMKINFQEDWKIITLFIGSNDLCDFCNDPARYSLQNFTDN
IGKALDILHAEVPRAFVNLVKTLQIFNLRELYQESSVSCPRLILRSLCPCVLKFDDNSTE
LASLVELNKKYQEGTHELVESGRYDTREDFTVVVQPFFEKVDMPKTSEGLPDSSFFAPDC
FHFSSKAHAHAASALWNNMLEPVGQKTTQHNFESKINIACPNQVWPFLSTYKNSVQDHGS
QLSCRDTAPSPSTPTSVHSLRPADIQVVAALGDSLTAGNGIGSKPNDLPDVTTQYRGLSY
SSGGDGSLENVTTLPNILRKFNGNLTGYAVGTGDANATNAFLNQAVSGAKAEELTNQVQA
LVQRMKDDHRVNFHEDWKVITVLIGNSDLCDYCTDSNLYSAANFFEHLRNALDILHREVP
RALVNLVDFMSPSVVRQVFLGNPDKCPVQQASVLCNCVLTPRESSQELARLEAIAQAYQS
SMRELVESGRYDTQEDFSVVLQPFFHNIQLPILADGHLDLSFFAPDCIHPSQKFHSQLSR
ALWVNMLEPLGRKMDTLDLPADIPLSCPTQSDSFLRTSRNSNYTYPTKPAVENWGSDFLC
TEWNPPNSVPTSVHELQPADIKVVAALGDSLTTAVGARPSNTSELPMSWRGLSWSIGGDG
ILETHTTLPNILKKFNPHILGFSTGTQEETAGLNVAVEGARARDMPAQARDLVERMKNSP
EINLEKDWKLITLFIGSSDLCHYCEHPEAYSAGEYVQHIQQALDILYELPRAFVNVVKVM
ELAGLYQSQGGKCYMSLGAQSNCTCLRRSQDNSSEMQELKKVNWNFQSGISRFSYQHQYL
QREDFAVVVQPFFQNTLVPLSERGDTDLTFFSEDCFHFSERGHAEMAIALWNNMLEPVGH
KTTANNFTHSRTKLKCPSPESPYLYTLRNSGLLQDQAEAGPQVISWAVPVAAGGGLAVGV
GTVMVWRAIRGRQRENLPMSLNSMGL
NT seq 4401 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcccgagacacctggaggattctggcatggggctacgaccacacattttcctc
ctggggctgctcctgcttctgggccaagggaccacccaggcccatacttctcctggagaa
aatacattggaagagcagttatggccagagaccctgaagaattttctgttatgcaaccca
aagaagtcaggatccagtgtgccttctaagtcagtccactctctgagaccttctgatatt
aaatttgtggcagccattggcgatgtggaaactcctccagactcagggacagtcgacgtg
gagaagcaaaaatggactgacaaactgccacagcaggagtgcttgggagtggtgacagtc
ctttcagacgtcatcagacacttcagtccctctgttctgaggcccgtgtgtgcccctagg
gagagagtgataccctccactggtgctgaagacttatggattcaggccaaagacctggtg
aggagcatgaaggagaaccagcaacttgactttcaaaatgactggaagctcatcaatgtg
ttcttcagtaatgcaagccaggatcacctatgtccctccacccaacaggaaagccgtgtg
acgagtggcatggacaagctgactagaaccctggactacctgcaccaggaggtccccaaa
gcatttgtgaacctggtggatctctctgaggcgatgggggtctctccctggcatcagggg
acccagctcagccctgcagcagagccccatgggtgctcagagacctctaggctgtctaag
gctgtggcacagtggtcctatcaggaaagctgggaacgtctcctggcctccagcaagtat
aacgagcaggggtccttcgcggtggttttccagcccttcttctacgagacagccctgttg
ggggagcagccactccaggatcccaccacactcgccttgaatctctggaacaacatgatg
gagccagcaggacagaaagatgagccattcagcgcaaaagagaggaggccggtgaaatgt
ccttctgaggagaatccctatctgttcacctacaggaacagcaactacctgcccatgtca
ccaaaactccatgagaggcttgaggtgagagaaggaacggaaatcgagtgccctgacaag
gacccctccgactcgattcccacctcagttcacaggctgaagctggcggacatcaaggta
atcggagcactgggcgactctctcacggcagctaacggggccgggtccacacctgggaac
ttgctggacgtcttgactcagtatcgaggcctgtcctggagctgcggcggcgaccagaac
ctgagcagcgtcaccaccctgcccaacatcctccgggaattcaacccttccttgatgggc
ttctctgttggcactgggaacgaaaacagtcctggagccttcctaaaccaggccgtggca
ggagccacaactgaggggttacctgctcaggccagaaggctggtggacctgatgaagaat
gacatgaagataaattttcaggaagattggaagataataaccttgtttataggaagcaat
gacctctgcgatttctgcaatgacccggcccgctattctctccagaacttcacagacaac
attgggaaggctctggacatcctccatgctgaggttcctcgggcatttgtgaacctggta
aagacgctgcagattttcaacctgagggagctgtaccaggagagtagtgtcagctgccca
aggctgatcctcaggtctctgtgcccctgtgtcctgaagtttgacgacaactccacagaa
cttgcctccctcgtggaactgaataagaagtatcaggaggggactcatgagctggtggag
agtgggcgatacgacacgagggaagattttacagtggtcgtgcagccgttctttgaaaaa
gtggacatgccaaagacctcggaggggttgcctgacagctctttcttcgctcctgactgt
ttccacttcagtagcaaggctcatgcccatgcagccagtgctctctggaataacatgctg
gaacccgtcggccagaagacaacacagcataattttgaaagcaagatcaatatcgcatgt
ccaaaccaggtctggccatttctgagcacctacaagaacagcgtgcaggatcatgggagc
cagctgtcgtgcagggacacagctccttctccctcgacgcccacctcagtacactccctg
agacctgcagatatccaagttgtggctgctctgggggattctctgactgctggcaatgga
attggctccaaaccaaacgaccttcctgacgtcaccactcagtatcgggggctgtcatat
agttcaggaggggacggctccctggagaatgtgaccaccttaccgaatatccttcgaaag
tttaacggcaatctcacaggctacgcggtaggcacgggtgacgccaatgccacaaatgcg
ttcctcaatcaggctgtttctggagcaaaggctgaggaacttacaaaccaagtccaggct
ctggtgcagaggatgaaagatgaccatagagtaaatttccatgaggactggaaggtcatc
acggtgctgattggaaacagcgatttgtgtgactactgcacggactcgaatctgtattct
gcagccaatttttttgagcatctccgcaacgccttggacatcctgcacagagaggtgccc
agagccctggtcaacctcgtggacttcatgagccccagcgtcgtgcggcaggtgttcctg
gggaacccagacaagtgtccggtacagcaggccagtgttctgtgtaactgtgttctgacc
ccgcgggagagctcccaagagctggccaggttggaggccatcgcccaagcctaccagagc
agcatgcgtgagctggtggagtcgggtcgctacgacacccaggaggacttctctgtggtc
ctgcagcctttcttccacaacatccagctccccatcctggcggatgggcacctggatttg
tccttcttcgccccagactgcatccacccaagtcagaaattccactcccagctctccaga
gccctctgggtcaacatgcttgaaccactaggaaggaaaatggatacgctggacctgcca
gcagacatccccctctcctgccccactcagagcgattccttcctgagaacttcccggaac
agtaactacacataccccaccaagccagccgttgagaactggggcagtgacttcctgtgt
accgagtggaatcctcccaacagtgttcccacctcggtccatgagctccaaccagcagac
atcaaagtggtggccgccctgggtgactccctgactacagccgtgggagcccgcccaagc
aacaccagtgagctacccatgtcctggaggggactttcctggagcattggaggggatgga
atcttggagacccacaccacactgcccaacattctaaagaagttcaaccctcacatcctc
gggttctccaccggcacacaggaggagacggcaggactgaatgtagcagtggaaggggcc
agagctcgggacatgccggcccaggcccgggacctggtggagcgaatgaaaaacagtcct
gaaatcaacctagagaaagactggaagctgatcacactcttcatcgggagcagcgacttg
tgtcattactgcgagcatccggaggcctactcagctggggaatatgttcagcacatccag
caggctctggacatcctctatgagcttccaagggctttcgtcaatgtggtgaaggtcatg
gagctggctggcctgtaccagagccaaggcgggaaatgctacatgtcactgggagctcag
agcaactgcacttgcctcagacgctcccaggacaactcctcagagatgcaagaactgaag
aaagtgaactggaacttccagagtggcatttccaggttctcctaccagcaccagtacctg
cagcgtgaggacttcgcggtggtcgtgcagcccttcttccagaacactcttgtccccttg
agcgagagaggagacactgacctcaccttcttctcggaggactgtttccacttctcagaa
cgtggtcatgctgagatggccatcgctctgtggaacaacatgctggaaccagtaggccat
aagacaaccgccaacaacttcacccacagcaggaccaaactcaagtgcccctctcctgag
agtccttacctctacaccctgaggaacagcgggctactccaagaccaggctgaagcaggc
ccccaggtgatctcctgggccgtgccagtagcagcaggaggtggcctcgcagttggcgtt
ggcacagtcatggtgtggagagccatacgaggtcgccagagggaaaatctgccaatgagc
ctgaacagtatgggcctctag

DBGET integrated database retrieval system