KEGG   Equus caballus (horse): 100071296Help
Entry
100071296         CDS       T01058                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100071296 (NCOA3)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100071296 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
22
AA seq 1404 aa AA seqDB search
MSGLGENSLDPLAPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAISNDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVAWTSETQRQKSHTFNCRMLMKTPHDVLEDINTSPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSSSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNSNPVGQGVRPPAAGCNASVGGMSMSPNQGLQMLSSRTYGL
ADPSTTGQMSGARYGPSSSMASMNPGPGMQSPSSYQNNNYGLSMSSPPHGSPGLGSNQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTGSHNFSSSSLSALQAISDGVGTSLLS
TLSSPGPKLDNSPNMSITQPNKVNSQDSKSPLGLYCDQNPVESSICQSNSRDHHSDKESK
ESSVEGSENQRGPLESKGHKKLLQLLTCSDDRGHSSLTSSPLDSSCKDSSISVTSPSGVS
SSTSGGVSSTSSMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTTSCVEGN
VKQEQLSPKKKENNALLRYLLDRDDPSDTLSKELQPKVEGADSKMSQCSSSTIPSSGQEK
DSKIKTETNEEGSGDLDNLDAILGDLTSSDFYNNSISTNDNNLGTKQHMFQGTNSLGLRS
PQLVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPVLGGNPRMMDSQESYGSN
IGGPNRNVTVNQTPPSGDWALPNSKASRMEPMSSNSMGRPGADYNAPLPRPAMGGSMPTL
PLRSNSIPGARPMLQQQQQQQQQQMLQMRPGEIPMAMGVSPYGQAAPSNQPGSWPDGMLS
MEQGPHGTQNRPLLRSSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRAL
GIPELVNQGQALEPKQDAFQGQEAAVMMDQKAALYGQTYPAQGPPMQGGFNLQGQSPSFN
SMMNQMNQQGSFPLQGMHPRANIMRPRTSTPKQLRMQLQQRLQGQQFLNQSRQALEMKIE
NPPAGSAAVMRPLMQPQVNSQQGFLNAQMVTQRSRELLSHHFRQQRVALLMQQQQQTQAF
SPPPNVTASPSMDGVLAGPVMPQAPPQQFPYPPNYGMGQQSDPAFGRVSSPPNAMISSRM
GASQNPMMQHPQTAPMYQSSEMKGWPSGNLARNSSFSQQQFAHQGNPAAYSMVHMNGSSG
PMGQMNMNSMPMSGMPMGPDQKYC
NT seq 4215 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagaaaactccttggatccactggcccctgattcacgaaaacgaaaa
ttgccgtgtgataccccaggacaaggtcttacctgcagtggtgaaaagtggagacgggag
caggagagtaaatacattgaagaattggctgaactgatatctgctaatcttagtgatatt
gacaatttcaatgtcaaaccagataaatgtgcaattttaaaggaaacagtaagacagata
cgtcagataaaagagcaaggaaaagctatttccaatgatgacgatgttcagaaagctgac
gtgtcttctacaggacagggagttattgataaagactccttaggaccacttttacttcag
gcattggatggtttcctgtttgtggtgaatcgtgatggaaacattgtatttgtgtcagaa
aatgtcacacaatacctgcaatataagcaagaggacctggttaacacaagtgtctacaat
atcttgcatgaagaggacagaaaggattttcttaagaacttacccaaatctacagttaat
ggagttgcctggacaagtgagacccagagacaaaaaagccatacgtttaattgccgtatg
ttgatgaaaacaccacatgatgttctggaagacataaacactagtcctgaaatgcgccag
agatatgagaccatgcagtgctttgccctgtctcagccgcgagctatgatggaggagggg
gaagatttgcaatcctgtatgatctgtgtggcacgccgcattaccacaggagaaagagca
tttccatcgaaccctgaaagctttattactagacatgatctttcaggaaaagttgtcaat
atagatacaaattcgctgagatcctccatgaggcctggctttgaagatataatccgaagg
tgtatccagagattttttagtcttaacgatgggcagtcatcgtcccagaaacgtcactat
caagaagcttatatccacggccacgcagaaaccccagtgtatcgattctctttggctgat
ggaactatagtgactgcacaaacaaaaagcaagctcttccgaaaccctgtcacaaacgac
cgtcatggctttgtctcaacccattttcttcagagggaacagaatgggtatagaccaaac
tcgaatcctgttggacaaggcgttagacctccagctgctggatgcaatgcttcggtaggc
ggcatgagcatgtctccaaaccaaggcttacagatgctgagcagcaggacctatggcttg
gctgaccccagcaccacagggcagatgagtggcgctaggtatgggccttccagtagcatg
gcttcaatgaaccctgggccaggcatgcagtcgccatcttcctaccaaaacaacaactat
ggtctcagcatgagcagccccccacacgggagtcctggtcttggctccaaccaacagaat
atcatgatttctcctcgtaatcgtgggagtccaaagatggcttcacatcagttttctcct
gtggcaggtgtgcactctcccatgggatcttctggcaatactgggagccacaacttttct
agcagctccctcagtgctcttcaagctatcagtgacggtgtggggacttctcttttatct
actctgtcttcaccaggccccaaattagataactctcccaatatgagtataacccaacca
aataaagtgaacagtcaggattccaagagtcccctaggcttgtattgtgaccagaatcca
gtggagagttcaatatgtcagtcaaatagcagagatcaccacagtgacaaagaaagtaag
gagagtagtgtcgaagggtcggagaatcaaaggggtcctctagaaagcaaaggtcataaa
aaattactgcagttacttacctgttctgatgaccggggccattcctccttgaccagctct
cccctggattcaagttgtaaagactcttccattagtgtcaccagcccctctggggtctcc
tcttcgacatctggaggagtgtcctccacatccagtatgcatgggtcactgctgcaagag
aagcaccggattttgcataagttgctgcagaatgggaattcaccagctgaagttgccaag
attaccgcagaagccaccgggaaagacaccagtagtacaacgtcttgtgtggaaggaaat
gtcaagcaggagcaactaagtcctaagaagaaggaaaataacgcactgcttagatatctg
ctggacagggatgatcctagcgacaccctctctaaagagctgcagcccaaggtggaggga
gcggacagtaagatgagtcagtgcagcagctccaccattcccagctcaggtcaagagaaa
gactctaaaattaagacagaaacaaacgaagagggatctggagatttggataatctcgat
gctattcttggtgatctgactagttctgacttttacaataattccatatccacaaatgat
aataacctgggaaccaagcaacacatgtttcaaggaactaattctctgggtttgaggagt
ccacagttggtgcagtccattcgtcctccgtataaccgagcagtgtctctagacagccct
gtttctgttggctcaagtcctccagtaaagaatatcagtgctttccccatgttaccaaag
cagcccgtgttgggtgggaatccaaggatgatggatagtcaggaaagttatggctcaaat
ataggtggtccaaacagaaatgtgactgtgaatcagactcctccttcaggagactgggcc
ttaccaaactcaaaggccagcaggatggaacctatgagttcaaactccatgggaagacca
ggagcagattataatgctcctttacccagacctgcaatgggtggctcaatgcccaccttg
cctcttcggtccaatagcatcccaggtgcaagaccaatgttgcagcagcagcagcagcaa
cagcagcaacagatgcttcaaatgcggcctggtgagattcccatggcaatgggggtcagt
ccttatggccaagcagcaccatctaaccaaccaggttcctggccagatggcatgttgtcc
atggaacaaggtcctcatgggactcaaaacaggccacttcttaggagttccctggatgat
ctccttgggccaccttcaaacctagaaggtcagagtgatgaaagagcattgttggaccaa
ctgcacactctcctgagcaacacagatgccacaggcctggaagaaattgacagagctctg
ggcatccctgaacttgtaaatcaaggacaagctttggagcccaaacaggatgcttttcaa
ggtcaagaagcggcagtgatgatggatcagaaggcagcattatatgggcagacgtacccg
gcacaggggcctccaatgcaagggggctttaatcttcagggacagtcaccatcttttaac
tctatgatgaatcagatgaaccagcagggcagttttcctctccaaggaatgcacccaagg
gccaacatcatgagaccccggacgagcacccccaagcaacttagaatgcagctgcagcag
aggctgcagggccagcagttcttgaatcagagccgtcaggcacttgaaatgaaaatagaa
aacccccctgctggcagtgctgcagtgatgaggcctctgatgcagccgcaggtgaactcc
cagcagggttttctcaacgcccagatggtcacgcagcgcagcagggagctcctgagtcat
cacttccgacagcagagggtggccctgctgatgcagcagcagcagcaaacccaggccttc
agcccgccccccaacgtgactgcttcccccagcatggacggggtcctggcagggcctgtg
atgccacaggctccccctcagcagtttccatatccacccaattatgggatgggacaacaa
tcagatccagcctttggtcgagtgtctagtcctcccaatgcaatgatatcatcaagaatg
ggtgcctcccagaatcccatgatgcagcaccctcagactgcacccatgtatcagtcctca
gaaatgaagggctggccatcaggaaacctggccaggaacagctccttttctcagcagcag
tttgcccaccaggggaatcctgcagcgtatagtatggtgcacatgaatggcagcagtggt
cccatgggacaaatgaacatgaactccatgcctatgtcgggcatgcccatgggcccagat
cagaaatactgctga

DBGET integrated database retrieval system