KEGG   Equus caballus (horse): 100071296Help
Entry
100071296         CDS       T01058                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3 isoform X1
  KO
K11256  nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb04915  Estrogen signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb05200  Pathways in cancer
ecb05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    100071296 (NCOA3)
   04919 Thyroid hormone signaling pathway
    100071296 (NCOA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100071296 (NCOA3)
   05224 Breast cancer
    100071296 (NCOA3)
  Drug resistance
   01522 Endocrine resistance
    100071296 (NCOA3)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100071296 (NCOA3)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100071296 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NCOA_u2 PAS_11 DUF4927 SRC-1 DUF1518 Nuc_rec_co-act PAS PAS_3 PAS_9 PAS_4 HLH PAS_2
Motif
Other DBs
NCBI-GeneID: 100071296
NCBI-ProteinID: XP_023482451
Ensembl: ENSECAG00000020850
Position
22
AA seq 1405 aa AA seqDB search
MSGLGENSLDPLAPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAISNDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVAWTSETQRQKSHTFNCRMLMKTPHDVLEDINTSPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSSSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNSNPVGQGVRPPAAGCNASVGGMSMSPNQGLQMLSSRTYGL
ADPSTTGQMSGARYGPSSSMASMNPGPGMQSPSSYQNNNYGLNMSSPPHGSPGLGSNQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTGSHNFSSSSLSALQAISDGVGTSLLS
TLSSPGPKLDNSPNMSITQPNKVNSQDSKSPLGLYCDQNPVESSICQSNSRDHHSDKESK
ESSVEGSENQRGPLESKGHKKLLQLLTCSDDRGHSSLTSSPLDSSCKDSSISVTSPSGVS
SSTSGGVSSTSSMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTTSCVEGN
VKQEQLSPKKKENNALLRYLLDRDDPSDTLSKELQPKVEGADSKMSQCSSSTIPSSGQEK
DSKIKTETNEEGSGDLDNLDAILGDLTSSDFYNNSISTNDNNLGTKQHMFQGTNSLAGLR
SPQLVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPVLGGNPRMMDSQESYGS
NIGGPNRNVTVNQTPPSGDWALPNSKASRMEPMSSNSMGRPGADYNAPLPRPAMGGSMPT
LPLRSNSIPGARPMLQQQQQQQQQQMLQMRPGEIPMAMGVSPYGQAAPSNQPGSWPDGML
SMEQGPHGTQNRPLLRSSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRA
LGIPELVNQGQALEPKQDAFQGQEAAVMMDQKAALYGQTYPAQGPPMQGGFNLQGQSPSF
NSMMNQMNQQGSFPLQGMHPRANIMRPRTSTPKQLRMQLQQRLQGQQFLNQSRQALEMKI
ENPPAGSAAVMRPLMQPQVNSQQGFLNAQMVTQRSRELLSHHFRQQRVALLMQQQQQTQA
FSPPPNVTASPSMDGVLAGPVMPQAPPQQFPYPPNYGMGQQSDPAFGRVSSPPNAMISSR
MGASQNPMMQHPQTAPMYQSSEMKGWPSGNLARNSSFSQQQFAHQGNPAAYSMVHMNGSS
GPMGQMNMNSMPMSGMPMGPDQKYC
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagaaaactccttggatccactggcccctgattcacgaaaacgaaaa
ttgccgtgtgataccccaggacaaggtcttacctgcagtggtgaaaagtggagacgggag
caggagagtaaatacattgaagaattggctgaactgatatctgctaatcttagtgatatt
gacaatttcaatgtcaaaccagataaatgtgcaattttaaaggaaacagtaagacagata
cgtcagataaaagagcaaggaaaagctatttccaatgatgacgatgttcagaaagctgac
gtgtcttctacaggacagggagttattgataaagactccttaggaccacttttacttcag
gcattggatggtttcctgtttgtggtgaatcgtgatggaaacattgtatttgtgtcagaa
aatgtcacacaatacctgcaatataagcaagaggacctggttaacacaagtgtctacaat
atcttgcatgaagaggacagaaaggattttcttaagaacttacccaaatctacagttaat
ggagttgcctggacaagtgagacccagagacaaaaaagccatacgtttaattgccgtatg
ttgatgaaaacaccacatgatgttctggaagacataaacactagtcctgaaatgcgccag
agatatgagaccatgcagtgctttgccctgtctcagccgcgagctatgatggaggagggg
gaagatttgcaatcctgtatgatctgtgtggcacgccgcattaccacaggagaaagagca
tttccatcgaaccctgaaagctttattactagacatgatctttcaggaaaagttgtcaat
atagatacaaattcgctgagatcctccatgaggcctggctttgaagatataatccgaagg
tgtatccagagattttttagtcttaacgatgggcagtcatcgtcccagaaacgtcactat
caagaagcttatatccacggccacgcagaaaccccagtgtatcgattctctttggctgat
ggaactatagtgactgcacaaacaaaaagcaagctcttccgaaaccctgtcacaaacgac
cgtcatggctttgtctcaacccattttcttcagagggaacagaatgggtatagaccaaac
tcgaatcctgttggacaaggcgttagacctccagctgctggatgcaatgcttcggtaggc
ggcatgagcatgtctccaaaccaaggcttacagatgctgagcagcaggacctatggcttg
gctgaccccagcaccacagggcagatgagtggcgctaggtatgggccttccagtagcatg
gcttcaatgaaccctgggccaggcatgcagtcgccatcttcctaccaaaacaacaactat
ggtctcaacatgagcagccccccacacgggagtcctggtcttggctccaaccaacagaat
atcatgatttctcctcgtaatcgtgggagtccaaagatggcttcacatcagttttctcct
gtggcaggtgtgcactctcccatgggatcttctggcaatactgggagccacaacttttct
agcagctccctcagtgctcttcaagctatcagtgacggtgtggggacttctcttttatct
actctgtcttcaccaggccccaaattagataactctcccaatatgagtataacccaacca
aataaagtgaacagtcaggattccaagagtcccctaggcttgtattgtgaccagaatcca
gtggagagttcaatatgtcagtcaaatagcagagatcaccacagtgacaaagaaagtaag
gagagtagtgtcgaagggtcggagaatcaaaggggtcctctagaaagcaaaggtcataaa
aaattactgcagttacttacctgttctgatgaccggggccattcctccttgaccagctct
cccctggattcaagttgtaaagactcttccattagtgtcaccagcccctctggggtctcc
tcttcgacatctggaggagtgtcctccacatccagtatgcatgggtcactgctgcaagag
aagcaccggattttgcataagttgctgcagaatgggaattcaccagctgaagttgccaag
attaccgcagaagccaccgggaaagacaccagtagtacaacgtcttgtgtggaaggaaat
gtcaagcaggagcaactaagtcctaagaagaaggaaaataacgcactgcttagatatctg
ctggacagggatgatcctagcgacaccctctctaaagagctgcagcccaaggtggaggga
gcggacagtaagatgagtcagtgcagcagctccaccattcccagctcaggtcaagagaaa
gactctaaaattaagacagaaacaaacgaagagggatctggagatttggataatctcgat
gctattcttggtgatctgactagttctgacttttacaataattccatatccacaaatgat
aataacctgggaaccaagcaacacatgtttcaaggaactaattctctggcaggtttgagg
agtccacagttggtgcagtccattcgtcctccgtataaccgagcagtgtctctagacagc
cctgtttctgttggctcaagtcctccagtaaagaatatcagtgctttccccatgttacca
aagcagcccgtgttgggtgggaatccaaggatgatggatagtcaggaaagttatggctca
aatataggtggtccaaacagaaatgtgactgtgaatcagactcctccttcaggagactgg
gccttaccaaactcaaaggccagcaggatggaacctatgagttcaaactccatgggaaga
ccaggagcagattataatgctcctttacccagacctgcaatgggtggctcaatgcccacc
ttgcctcttcggtccaatagcatcccaggtgcaagaccaatgttgcagcagcagcagcag
caacagcagcaacagatgcttcaaatgcggcctggtgagattcccatggcaatgggggtc
agtccttatggccaagcagcaccatctaaccaaccaggttcctggccagatggcatgttg
tccatggaacaaggtcctcatgggactcaaaacaggccacttcttaggagttccctggat
gatctccttgggccaccttcaaacctagaaggtcagagtgatgaaagagcattgttggac
caactgcacactctcctgagcaacacagatgccacaggcctggaagaaattgacagagct
ctgggcatccctgaacttgtaaatcaaggacaagctttggagcccaaacaggatgctttt
caaggtcaagaagcggcagtgatgatggatcagaaggcagcattatatgggcagacgtac
ccggcacaggggcctccaatgcaagggggctttaatcttcagggacagtcaccatctttt
aactctatgatgaatcagatgaaccagcagggcagttttcctctccaaggaatgcaccca
agggccaacatcatgagaccccggacgagcacccccaagcaacttagaatgcagctgcag
cagaggctgcagggccagcagttcttgaatcagagccgtcaggcacttgaaatgaaaata
gaaaacccccctgctggcagtgctgcagtgatgaggcctctgatgcagccgcaggtgaac
tcccagcagggttttctcaacgcccagatggtcacgcagcgcagcagggagctcctgagt
catcacttccgacagcagagggtggccctgctgatgcagcagcagcagcaaacccaggcc
ttcagcccgccccccaacgtgactgcttcccccagcatggacggggtcctggcagggcct
gtgatgccacaggctccccctcagcagtttccatatccacccaattatgggatgggacaa
caatcagatccagcctttggtcgagtgtctagtcctcccaatgcaatgatatcatcaaga
atgggtgcctcccagaatcccatgatgcagcaccctcagactgcacccatgtatcagtcc
tcagaaatgaagggctggccatcaggaaacctggccaggaacagctccttttctcagcag
cagtttgcccaccaggggaatcctgcagcgtatagtatggtgcacatgaatggcagcagt
ggtcccatgggacaaatgaacatgaactccatgcctatgtcgggcatgcccatgggccca
gatcagaaatactgctga

DBGET integrated database retrieval system