KEGG   Equus caballus (horse): 100071381Help
Entry
100071381         CDS       T01058                                 

Gene name
HADHA
Definition
(RefSeq) trifunctional enzyme subunit alpha, mitochondrial
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb00071  Fatty acid degradation
ecb00280  Valine, leucine and isoleucine degradation
ecb00310  Lysine degradation
ecb00380  Tryptophan metabolism
ecb00410  beta-Alanine metabolism
ecb00640  Propanoate metabolism
ecb00650  Butanoate metabolism
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
ecb01212  Fatty acid metabolism
Module
ecb_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
ecb_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
ecb_M00085  Fatty acid biosynthesis, elongation, mitochondria
ecb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100071381 (HADHA)
   00650 Butanoate metabolism
    100071381 (HADHA)
  Lipid metabolism
   00062 Fatty acid elongation
    100071381 (HADHA)
   00071 Fatty acid degradation
    100071381 (HADHA)
   01040 Biosynthesis of unsaturated fatty acids
    100071381 (HADHA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100071381 (HADHA)
   00310 Lysine degradation
    100071381 (HADHA)
   00380 Tryptophan metabolism
    100071381 (HADHA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100071381 (HADHA)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100071381 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100071381 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 100071381
NCBI-ProteinID: XP_001502833
Ensembl: ENSECAG00000015725
UniProt: F6TVY8
Position
15
AA seq 762 aa AA seqDB search
MASRAIGSFRRFPASKTLRCPGYICRNFAGSSALLTRTHINYGVKGDVAVVRINSPNSKV
NTLNKELQSEFVEVMNEIWASDQIRSAVLISSKPGCFIAGADINMLAACKTNQEVTQISQ
EGQRIFEKLEKSPKPIVAAISGSCLGGGLELAISCQYRIATKDKKTVLGSPEVLLGILPG
AGGTQRLPKMVGVPAAFDMMLTGRNIHADRAKKMGLVDQLVEPLGPGLKPPEERTIEYLE
EVAVTFAKGLADKKISPKRDKGLVDKLTSVAMGIPFVRQQIYKKVEEKVRKQTKGLYPAP
LKIIDVVKTGIEQGSDAGYLSESQKFGELAMTKESKALIGLYHGQVLCKKNKFGAPQKEV
KHLAILGAGLMGAGIAQVSVDKGLKTILKDATLAGLGRGQQQVFKGLNDKVKKKALTSFE
RDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCVFASNTSALPI
NEISAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTTASAVAVGLKQGKVIIVVKD
GPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVARHVAE
DLGKAFGERFGGGSLDLLKQMVSKGFLGRKSGKGFYIYQEGVKSKNLNSDMDSILASLKI
PPKSEVSSDEDIQYRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFV
DLYGAQKIVDRLRKYEAAYGKQFTPCQLLVDHANSPNKKFYQ
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcgggctattggcagcttcaggcgcttccctgcgtccaagacgctccgctgc
ccaggttatatttgccgcaactttgcagggtcctctgctttgctgaccagaacccatatt
aactatggagtcaaaggggatgtggcagttgttcgaattaactcacccaattcaaaggta
aatacactgaataaggaactgcaatcagagttcgtagaagtcatgaatgaaatctgggcc
agcgatcaaatcagaagtgccgtccttatctcatcaaagccaggctgttttattgcaggt
gctgatatcaacatgttagctgcttgcaagaccaatcaagaggtaacgcaaatatcccag
gaaggacagagaatctttgagaaacttgagaagtccccaaagcctattgtggcggccatc
agtggatcctgcctaggaggaggacttgagcttgccatttcatgccaatacagaatagca
acaaaagataaaaaaacagtgttaggttcccctgaagttttgctggggatcttaccagga
gcaggaggcacacaaaggctgcccaaaatggtgggagtgcctgctgctttcgacatgatg
ctgactggtagaaacattcatgcagacagagcaaagaaaatgggactggttgaccaattg
gtggaacccctgggaccaggattaaagcctccagaggaacggacaattgaatacctagaa
gaagttgcagttacttttgccaaaggactagctgataagaaaatctctccgaagagagac
aaaggattggtggacaaattgacatcggtcgccatgggtattccatttgtcaggcaacag
atttacaaaaaggtggaagaaaaagtacgaaagcagaccaaaggcctttatcctgcacct
ctgaaaataattgatgtcgtaaagactggaatcgagcaagggagtgatgctggctatctc
tctgaatctcagaaattcggagagcttgcaatgaccaaagaatccaaggccttgatagga
ctttaccatggtcaggtcctgtgcaagaagaataaatttggagctccgcaaaaggaggtt
aagcacttagccattcttggtgcagggctgatgggagccggcattgcccaagtctctgtg
gataagggcctgaagactatacttaaagatgctaccctagccgggctgggccgaggacag
caacaagtgttcaaaggattgaatgataaagtgaagaagaaagctctaacatcatttgaa
agggactccattttcagcaacttgactgggcagcttgattaccagggttttgaaaaggcc
gacatggtgattgaagctgtttttgaggaccttagtcttaagcacagagtgctaaaggaa
gtagaggcggtgattccagatcactgtgtctttgccagtaacacatctgctctcccaatc
aatgaaatttctgctgtcagcaaaagacctgagaaggtgattggcatgcactacttctcc
cctgtggacaagatgcagctgctggagatcatcacaaccgagaaaacttctaaggacacg
accgcttctgctgtagcagttggcctcaagcaggggaaggtcatcattgtggttaaggat
ggacctggcttctataccaccaggtgtctcgcccccatgatgtctgaagtcatcagaatt
ctccaggaaggagttgaccctaagaagctggattcccttaccacgagctttggcttccct
gtgggcgctgccacactggtggatgaagttggagtagatgtagcaagacacgtagcagaa
gatctgggcaaagcctttggggagcggtttggaggtggaagccttgacctgctgaagcag
atggtgtccaagggcttcctgggtcgcaagtctgggaagggcttttacatctaccaggag
ggcgtgaagagtaagaatttgaattctgacatggatagtatcttggcaagcctgaagata
cctcctaagtctgaggtctcctctgatgaagacattcagtaccgcctggtgacaagattt
gtgaatgaggccgtcatgtgcctgcaggaagggatcttggctacgcctgcagagggagac
atcggagcggtctttgggctcggcttcccaccctgtctaggagggcccttccgctttgtg
gatctgtacggcgctcagaagatagtggaccggctcaggaagtatgaggctgcctatgga
aaacagttcaccccgtgccagctgctagttgaccacgctaacagccctaacaagaagttc
taccagtga

DBGET integrated database retrieval system