KEGG   Equus caballus (horse): 100071433Help
Entry
100071433         CDS       T01058                                 

Gene name
USP47
Definition
ubiquitin specific peptidase 47
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 1494 aa AA seqDB search
MVPGEETYMDSKVVRGQRRMLGPDAAAARGSAGPGEGPVRSRRGRGGDREVIWEEKFWNS
CGWARWGDGAASGFDSGGAALSGLVKSTPCGRAELTVTTFLNSCYLVVLLACRSGAYRRS
SKSSKCDFHGKDVFWRCRQNIFDEMKKKFLQIENAAEEPRVLCIIQDTTNSKTVNERITL
NLPASTPLRKLFEDVANKVGYINGTFDLVWGNGINTADTAPLDHTSDKSLLDANFEPGKK
NFLHLTDKDGEQPQILLEDSSAGDDSVHDRFIGPLPREGSVGSTSDYVSQSYSYSSILNK
SETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVL
LQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQ
GKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQY
FCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTFID
VEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLENNSGTEKISKPGLEK
NSLIYELFSVMVHSGSAAGGHYYACIKSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSGS
RGYYSSAFASSTNAYMLIYRLKDPARNAKFLEVDEYPEHIKSLVQRERELEEQEKRQREI
ERNTCKIKLFCLHPVKQVMMENKLEVHKDKTLKEAVEMAYKMMDLEEVIPMDCCRLVKYD
EFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETRKPDQVFQSYKPGEVMVKVHVVD
LKAESVAAPITVRAYLNQTVTEFKQLISKTVVHLPAETMRIVLERCYNDLRLLTAPSKTL
KAEGFFRSNKVFVESSETLDYQMAFTDSHLWKLLDRHANTIRLFVLLPEQSPGSYSKRTA
YQKAGGDSGNVDDDCERVKGPVGSLKSVEAILEESTEKLKSLSLQQQQDGENGDSSKSTE
TSDFENIESPLNERDSSASVENRDLEQHIQTSDPENFQSEERSDSDVNNDRSTSSVDSDI
LSSSHSSDTLCNADNAQIPLANGLDSHSITSSRRTKANEGKKETWDTAEEDSGTDSEYDE
SGKSRGETQYMYFKAEPYAADAGSGEGHKWLMVHVDKRITLAAFKQHLEPFVGVLSSHFK
VFRVYASNQEFESVRLNETLSSFSDDNKITIRLGRALKKGEYRVKVYQLLVNEQEPCKFL
LDAVFAKGMTVRQSKEELIPQLREQCGLELSIDRFRLRKKTWKNPGTVFLDYHIYEEDIN
ISSNWEVFLEVLDGVEKMKSMSQLAVLSRRWRPSEMKLDPFQEVVLESSSVDELREKLSE
ISGIPLEDIEFVKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKT
EELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLAQD
NT seq 4485 nt NT seq  +upstreamnt  +downstreamnt
atggtccccggcgaggagacatatatggactcgaaagtggtgaggggccagcggaggatg
cttgggccggatgctgcggccgctcgaggcagcgcaggcccgggcgaggggccggtgcgg
tcccggcgggggcgaggaggagacagagaggtaatttgggaggagaaattctggaacagt
tgcggatgggcacgatggggtgacggggctgcttctggttttgacagtggcggtgcagcg
ctttcggggcttgtgaaatcgacaccttgtgggagggcagagttaactgttacgactttt
ttgaactcctgttacttagtagtcctgttggcctgccgaagtggggcctaccgaagatcg
tcgaaaagtagtaaatgtgactttcacgggaaggatgtgttttggagatgcagacaaaat
atctttgatgaaatgaagaagaaatttttacagatagaaaatgctgctgaagaacctaga
gtcttatgtataatacaagatactactaattcaaagacagtgaatgaacggatcacttta
aatttaccagcttctactccactcagaaagctctttgaagatgtggccaacaaagtaggc
tacataaatggaacctttgatttggtgtggggaaatggaatcaatactgctgatacggct
ccactggatcataccagtgacaagtctcttcttgatgctaattttgagccaggaaagaag
aactttctgcatttgacagataaagacggtgaacagcctcaaatactgctggaggattcc
agtgctggagatgacagtgtccatgacagatttataggtccacttccaagagaaggttct
gtgggctctaccagtgactatgtcagccaaagctactcttattcatctattttaaataaa
tcagaaactggatatgtgggattagtaaaccaagcaatgacttgctatttgaatagcctt
ttgcaaacactttttatgactcctgaatttaggaatgcattatataagtgggaatttgaa
gaatctgaagaagatccagtgacaagtatcccataccaacttcagaggctttttgttttg
ttacaaaccagcaaaaagagagcaattgaaaccacagatgttacaaggagctttggatgg
gatagtagtgaggcttggcagcagcatgatgtacaagaactgtgcagagtcatgtttgat
gctttagagcagaaatggaaacaaacagaacaggctgatcttataaatgaactatatcaa
ggcaagctgaaggactacgtgagatgtctggaatgtggttatgagggctggagaatcgac
acatatcttgatattcctttggtcatccgaccttatgggtccagccaggcgtttgctagt
gtggaagaagcgttgcatgcgtttattcagcctgagatcctggatggcccaaatcaatat
ttttgtgaacgttgtaagaagaagtgtgatgcacgaaagggtcttcggtttttgcatttc
ccttatctactgaccttacaattgaaaaggtttgattttgattatacaaccatgcacagg
attaaattgaatgatcggatgacatttcccgaggagctagatatgagtacatttattgat
gttgaagatgagaaatctccacagactgaaagctgcactgacagtggagcagaaaatgaa
ggcagttgccacagtgatcaaatgagcaatgatttctccaatgatgatggggtggatgaa
gggatctgcctcgaaaacaatagtggaactgaaaagatttcaaaacccggacttgaaaag
aattccttaatctatgagctcttctcagttatggttcattcagggagcgctgccggtggc
cattattacgcttgtataaagtccttcagtgatgaacagtggtacagcttcaatgatcaa
catgttagcaggataacacaagaggacattaagaaaacacatggtggatcttcaggaagc
agaggatattactccagtgcttttgcaagctccacaaatgcatacatgctgatatataga
ctgaaggacccagcaagaaatgcaaaatttctagaagtagatgaatatccagaacatatt
aaaagcttggtgcagagagagagagaattggaagaacaagaaaagaggcaacgagaaatt
gagcgcaatacatgcaagataaaattattctgtttgcatcctgtgaaacaagtaatgatg
gaaaataaattggaggttcataaggataagacattaaaggaagcagtagaaatggcgtat
aagatgatggatttggaagaggtaatacccatggattgctgtcgccttgttaaatatgat
gagtttcatgattatcttgaacggtcatatgagggagaagaagatacaccaatgggactt
ctgctaggtggagtcaagtcaacgtatatgtttgatctgctattggagacaagaaaacct
gatcaagttttccagtcttacaagcctggagaagtgatggtgaaggttcatgttgtggat
ctaaaggcagaatctgtagctgctcctatcactgttcgtgcttacttaaatcaaacagtc
acagagttcaaacagcttatttcaaagaccgttgtccatttacctgcggagacgatgaga
atagtgctggagcgctgctacaatgatctgcgtcttctcaccgcgcccagtaagaccctg
aaagctgaagggttttttagaagtaacaaggtgtttgttgaaagttcagagactttggat
taccagatggcctttacagactctcatttatggaaactcctggatcggcatgcaaataca
atcagattatttgttttgttacctgagcaatccccaggatcttattccaaaaggacagca
taccagaaagcagggggcgattctggtaatgtggatgatgactgtgaaagagtcaaaggg
cctgtggggagcctgaagtctgtggaagctattctagaagaaagcactgaaaaactcaaa
agcttgtcgctccagcagcagcaagatggagagaatggggatagcagcaaaagtactgag
acaagtgactttgaaaacatcgaatcgcctctcaatgagagggactcctcagcatcggtg
gaaaacagagaccttgaacagcatattcaaacctctgatcctgaaaactttcagtctgaa
gaacgatctgactcagatgtgaataatgacaggagtacaagttcagtggacagtgacatc
ctcagctccagtcatagcagtgatactttgtgcaatgcagataacgctcagatccccttg
gctaatggacttgactcccacagcatcacgagtagcagaagaactaaagcaaatgaaggg
aaaaaagagacgtgggatacagcagaagaggactctggaactgacagtgaatatgatgag
agtggcaagagcaggggcgagacacagtacatgtatttcaaagcagagccctatgctgca
gatgcaggctctggggaaggacacaaatggttgatggtgcacgttgataagagaattact
ctggccgctttcaaacaacacttagagccctttgttggagttttgtcctctcacttcaag
gtctttcgagtgtatgccagcaatcaagagtttgagagcgtccgcctgaatgagaccctg
tcgtcattttcagatgacaataagattacgattagactggggagagcacttaagaaagga
gagtaccgagttaaagtgtaccagcttctagtcaatgagcaagagccatgcaagtttctg
ctcgatgctgtgtttgctaaaggaatgactgtacggcaatcaaaagaggaattaattcct
caactcagggagcaatgtggcttagagctcagcattgacaggtttcgtctaaggaaaaaa
acatggaagaatcctggcactgtctttttggattatcatatctatgaagaagatattaat
atttccagcaactgggaggttttccttgaagttcttgacggggtggagaagatgaaatcc
atgtcacagcttgcagtcttgtccagacggtggaggccttcagagatgaagctggatccc
ttccaggaggtcgtgttggagagcagcagtgttgatgagttgcgagagaagctttctgaa
atcagtggaattcctttggaagatattgaatttgtcaagggtagaggaactttcccctgc
gacatttctgtcctcgacattcaccaggacttggactggaaccctaaagtctctaccctg
aacgtctggcctctttacatctgtgatgatggtgccgtcatattttatagggataaaaca
gaagaattaatggagttgacggatgagcaaagaaacgaactgatgaaaaaagaaagcagt
cgactccagaagacaggacatcgtgtaacatactcacctcggaaagagaaagcactaaaa
atatatctggatggagcaccaaataaagatctggctcaagactga

DBGET integrated database retrieval system