KEGG   Equus caballus (horse): 100071433Help
Entry
100071433         CDS       T01058                                 

Gene name
USP47
Definition
(RefSeq) ubiquitin specific peptidase 47
  KO
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100071433 (USP47)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100071433 (USP47)
Ubiquitin system [BR:ecb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100071433 (USP47)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 1435 aa AA seqDB search
MVPGEETYMDSKVVRGQRRMLGPDAAAARGSAGPGEGPVRSRRGRGGVVLLACRSGAYRR
SSKSSKCDFHGKDVFWRCRQNIFDEMKKKFLQIENAAEEPRVLCIIQDTTNSKTVNERIT
LNLPASTPLRKLFEDVANKVGYINGTFDLVWGNGINTADTAPLDHTSDKSLLDANFEPGK
KNFLHLTDKDGEQPQILLEDSSAGDDSVHDRFIGPLPREGSVGSTSDYVSQSYSYSSILN
KSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFV
LLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELY
QGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQ
YFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTFI
DVEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLENNSGTEKISKPGLE
KNSLIYELFSVMVHSGSAAGGHYYACIKSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSG
SRGYYSSAFASSTNAYMLIYRLKDPARNAKFLEVDEYPEHIKSLVQRERELEEQEKRQRE
IERNTCKIKLFCLHPVKQVMMENKLEVHKDKTLKEAVEMAYKMMDLEEVIPMDCCRLVKY
DEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETRKPDQVFQSYKPGEVMVKVHVV
DLKAESVAAPITVRAYLNQTVTEFKQLISKTVVHLPAETMRIVLERCYNDLRLLTAPSKT
LKAEGFFRSNKVFVESSETLDYQMAFTDSHLWKLLDRHANTIRLFVLLPEQSPGSYSKRT
AYQKAGGDSGNVDDDCERVKGPVGSLKSVEAILEESTEKLKSLSLQQQQDGENGDSSKST
ETSDFENIESPLNERDSSASVENRDLEQHIQTSDPENFQSEERSDSDVNNDRSTSSVDSD
ILSSSHSSDTLCNADNAQIPLANGLDSHSITSSRRTKANEGKKETWDTAEEDSGTDSEYD
ESGKSRGETQYMYFKAEPYAADAGSGEGHKWLMVHVDKRITLAAFKQHLEPFVGVLSSHF
KVFRVYASNQEFESVRLNETLSSFSDDNKITIRLGRALKKGEYRVKVYQLLVNEQEPCKF
LLDAVFAKGMTVRQSKEELIPQLREQCGLELSIDRFRLRKKTWKNPGTVFLDYHIYEEDI
NISSNWEVFLEVLDGVEKMKSMSQLAVLSRRWRPSEMKLDPFQEVVLESSSVDELREKLS
EISGIPLEDIEFVKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDK
TEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLAQD
NT seq 4308 nt NT seq  +upstreamnt  +downstreamnt
atggtccccggcgaggagacatatatggactcgaaagtggtgaggggccagcggaggatg
cttgggccggatgctgcggccgctcgaggcagcgcaggcccgggcgaggggccggtgcgg
tcccggcgggggcgaggaggagtagtcctgttggcctgccgaagtggggcctaccgaaga
tcgtcgaaaagtagtaaatgtgactttcacgggaaggatgtgttttggagatgcagacaa
aatatctttgatgaaatgaagaagaaatttttacagatagaaaatgctgctgaagaacct
agagtcttatgtataatacaagatactactaattcaaagacagtgaatgaacggatcact
ttaaatttaccagcttctactccactcagaaagctctttgaagatgtggccaacaaagta
ggctacataaatggaacctttgatttggtgtggggaaatggaatcaatactgctgatacg
gctccactggatcataccagtgacaagtctcttcttgatgctaattttgagccaggaaag
aagaactttctgcatttgacagataaagacggtgaacagcctcaaatactgctggaggat
tccagtgctggagatgacagtgtccatgacagatttataggtccacttccaagagaaggt
tctgtgggctctaccagtgactatgtcagccaaagctactcttattcatctattttaaat
aaatcagaaactggatatgtgggattagtaaaccaagcaatgacttgctatttgaatagc
cttttgcaaacactttttatgactcctgaatttaggaatgcattatataagtgggaattt
gaagaatctgaagaagatccagtgacaagtatcccataccaacttcagaggctttttgtt
ttgttacaaaccagcaaaaagagagcaattgaaaccacagatgttacaaggagctttgga
tgggatagtagtgaggcttggcagcagcatgatgtacaagaactgtgcagagtcatgttt
gatgctttagagcagaaatggaaacaaacagaacaggctgatcttataaatgaactatat
caaggcaagctgaaggactacgtgagatgtctggaatgtggttatgagggctggagaatc
gacacatatcttgatattcctttggtcatccgaccttatgggtccagccaggcgtttgct
agtgtggaagaagcgttgcatgcgtttattcagcctgagatcctggatggcccaaatcaa
tatttttgtgaacgttgtaagaagaagtgtgatgcacgaaagggtcttcggtttttgcat
ttcccttatctactgaccttacaattgaaaaggtttgattttgattatacaaccatgcac
aggattaaattgaatgatcggatgacatttcccgaggagctagatatgagtacatttatt
gatgttgaagatgagaaatctccacagactgaaagctgcactgacagtggagcagaaaat
gaaggcagttgccacagtgatcaaatgagcaatgatttctccaatgatgatggggtggat
gaagggatctgcctcgaaaacaatagtggaactgaaaagatttcaaaacccggacttgaa
aagaattccttaatctatgagctcttctcagttatggttcattcagggagcgctgccggt
ggccattattacgcttgtataaagtccttcagtgatgaacagtggtacagcttcaatgat
caacatgttagcaggataacacaagaggacattaagaaaacacatggtggatcttcagga
agcagaggatattactccagtgcttttgcaagctccacaaatgcatacatgctgatatat
agactgaaggacccagcaagaaatgcaaaatttctagaagtagatgaatatccagaacat
attaaaagcttggtgcagagagagagagaattggaagaacaagaaaagaggcaacgagaa
attgagcgcaatacatgcaagataaaattattctgtttgcatcctgtgaaacaagtaatg
atggaaaataaattggaggttcataaggataagacattaaaggaagcagtagaaatggcg
tataagatgatggatttggaagaggtaatacccatggattgctgtcgccttgttaaatat
gatgagtttcatgattatcttgaacggtcatatgagggagaagaagatacaccaatggga
cttctgctaggtggagtcaagtcaacgtatatgtttgatctgctattggagacaagaaaa
cctgatcaagttttccagtcttacaagcctggagaagtgatggtgaaggttcatgttgtg
gatctaaaggcagaatctgtagctgctcctatcactgttcgtgcttacttaaatcaaaca
gtcacagagttcaaacagcttatttcaaagaccgttgtccatttacctgcggagacgatg
agaatagtgctggagcgctgctacaatgatctgcgtcttctcaccgcgcccagtaagacc
ctgaaagctgaagggttttttagaagtaacaaggtgtttgttgaaagttcagagactttg
gattaccagatggcctttacagactctcatttatggaaactcctggatcggcatgcaaat
acaatcagattatttgttttgttacctgagcaatccccaggatcttattccaaaaggaca
gcataccagaaagcagggggcgattctggtaatgtggatgatgactgtgaaagagtcaaa
gggcctgtggggagcctgaagtctgtggaagctattctagaagaaagcactgaaaaactc
aaaagcttgtcgctccagcagcagcaagatggagagaatggggatagcagcaaaagtact
gagacaagtgactttgaaaacatcgaatcgcctctcaatgagagggactcctcagcatcg
gtggaaaacagagaccttgaacagcatattcaaacctctgatcctgaaaactttcagtct
gaagaacgatctgactcagatgtgaataatgacaggagtacaagttcagtggacagtgac
atcctcagctccagtcatagcagtgatactttgtgcaatgcagataacgctcagatcccc
ttggctaatggacttgactcccacagcatcacgagtagcagaagaactaaagcaaatgaa
gggaaaaaagagacgtgggatacagcagaagaggactctggaactgacagtgaatatgat
gagagtggcaagagcaggggcgagacacagtacatgtatttcaaagcagagccctatgct
gcagatgcaggctctggggaaggacacaaatggttgatggtgcacgttgataagagaatt
actctggccgctttcaaacaacacttagagccctttgttggagttttgtcctctcacttc
aaggtctttcgagtgtatgccagcaatcaagagtttgagagcgtccgcctgaatgagacc
ctgtcgtcattttcagatgacaataagattacgattagactggggagagcacttaagaaa
ggagagtaccgagttaaagtgtaccagcttctagtcaatgagcaagagccatgcaagttt
ctgctcgatgctgtgtttgctaaaggaatgactgtacggcaatcaaaagaggaattaatt
cctcaactcagggagcaatgtggcttagagctcagcattgacaggtttcgtctaaggaaa
aaaacatggaagaatcctggcactgtctttttggattatcatatctatgaagaagatatt
aatatttccagcaactgggaggttttccttgaagttcttgacggggtggagaagatgaaa
tccatgtcacagcttgcagtcttgtccagacggtggaggccttcagagatgaagctggat
cccttccaggaggtcgtgttggagagcagcagtgttgatgagttgcgagagaagctttct
gaaatcagtggaattcctttggaagatattgaatttgtcaagggtagaggaactttcccc
tgcgacatttctgtcctcgacattcaccaggacttggactggaaccctaaagtctctacc
ctgaacgtctggcctctttacatctgtgatgatggtgccgtcatattttatagggataaa
acagaagaattaatggagttgacggatgagcaaagaaacgaactgatgaaaaaagaaagc
agtcgactccagaagacaggacatcgtgtaacatactcacctcggaaagagaaagcacta
aaaatatatctggatggagcaccaaataaagatctggctcaagactga

DBGET integrated database retrieval system