KEGG   Equus caballus (horse): 100071472Help
Entry
100071472         CDS       T01058                                 

Gene name
ACACA
Definition
acetyl-CoA carboxylase alpha
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ecb  Equus caballus (horse)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ecb01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ecb00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ecb00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:ecb00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:ecb04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 2288 aa AA seqDB search
MEGSAEENKEMKYYMLQRSSMSGLHIVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVI
EKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPV
PGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMW
ALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFTKRILNVPQELYEKGYVKDVDDGL
KAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHL
EVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYV
SAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRM
MYGLSPWGDAPIDFENSAHVPCARGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVW
GYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLL
ETESFQLNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSISNFLHSLERG
QVLPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVVMNGSCVEVDVHRLSDGGLLLSY
DGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQC
YAEIEVMKMVMTLTAAESGCIHYVKRPGAALDPGCVIAKMQLDNPSKVQQAELHTGSLPR
IHSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLE
LQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSER
EVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENK
SDMNTVLNYIFSHAQVTKKNLLVTMLIVSIXGRDPTLTDELLNILTELTQLSKTSNAKVA
LRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFF
YHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLN
RMSFSSNLNHYGMTHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCD
SPPQSPTFPEAGHTSLYDEDKVPRNEPIHILNVAIKTDGDIEDDRLAAMFREFTQQKKST
LVEHGIRRLTFLVAQKDFRKQVNYEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALA
FQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEAS
FEYLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMR
YGSRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMF
QAYGDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMST
HAFLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPEGRDII
VIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIFVAANSGARIGLAEEIRHMFHVAW
VDPEDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLR
SSGMIAGESSLAYDEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAAALNKVL
GREVYTSNNQLGGIQIMHNNGVTHSKVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKDP
IDRIIEFVPTKAPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARL
GGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGL
PLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDP
TINPRHMEMYADRESRGSILEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSA
AERKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGIINDILDWKTSRTFFYWR
LRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQL
TEEDGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVVRIL
STMDSPST
NT seq 6867 nt NT seq  +upstreamnt  +downstreamnt
atggagggttctgcagaggaaaataaggagatgaaatattacatgcttcaaaggtccagc
atgtctggcttacacatcgtaaagcaaggtcgagaccggaagaaaatagactcacagcga
gatttcactgtagcttctccagcagaattcgttactcgttttggggggaataaagtgatt
gagaaggttcttattgccaacaatggcattgcagcagtgaaatgcatgcgatctatccgt
cggtggtcttatgagatgtttcgaaatgaacgtgcaatccgatttgttgtcatggtcaca
cctgaagaccttaaagccaacgcagaatacattaagatggcagatcactatgtcccagtg
cctggaggaccaaacaacaacaactatgcaaatgtggagttaattcttgatattgctaaa
aggatcccagtacaagcagtgtgggctggctggggtcatgcttctgagaatcccaaactc
ccagaactacttttgaaaaatggcattgccttcatgggtcctccaagccaggccatgtgg
gctttaggggataagattgcatcttccatagtggctcaaactgcaggtatcccaactctt
ccctggagtggcagtggtcttcgtgtggactggcaggaaaatgattttacaaaacgtatc
ttgaatgttccccaggaattatatgaaaaaggttatgtgaaggatgtggatgatgggcta
aaggcagcagaggaagttggatatccggtaatgatcaaggcctcagaaggcgggggaggg
aagggaatcagaaaagtcaacaatgcagatgacttccctaacctcttcagacaggttcaa
gctgaagtccctggatctcctatatttgtgatgagactagccaaacaatctcgtcatctg
gaggtacagatcttagcagatcagtatggcaatgcaatctctttgtttggtcgtgattgc
tctgtacagcgcaggcatcagaagattattgaagaggcacctgctgctattgctactcca
gcagtatttgaacatatggaacagtgtgctgtgaaacttgccaaaatggttggttatgtg
agtgctgggactgtggaatacctctacagccaggatggcagcttctactttctggaactg
aaccctcggctacaggtagagcacccttgtacagagatggtggctgatgtcaacctccct
gcagcacaactccagattgccatgggaatccctctatacagaatcaaggatatccgtatg
atgtatgggttatctccctggggtgatgctcccattgattttgaaaattctgctcacgtt
ccttgcgcaaggggccatgttattgctgctcggatcactagtgaaaatccagatgagggt
tttaagcccagctcaggaacagttcaggaactgaatttccgtagcaataagaatgtttgg
ggttatttcagtgttgctgctgcaggaggacttcatgaatttgctgattctcagtttggt
cactgcttttcctggggagaaaacagagaggaagcaatttcaaacatggtggtggctttg
aaggagctgtctattcggggtgactttcgaactacagttgaatatctgatcaaattgttg
gagactgaaagctttcagttgaatagaattgacactggctggttggacagactgatagcg
gaaaaagtacaggcagagcggcctgacaccatgctgggcgttgtgtgtggggctctccac
gtggcagatgtgagcctgcggaatagcatctctaacttccttcactccttagaaaggggt
caagtccttcctgctcatacccttctgaatacagtagatgttgaacttatctatgaagga
gtcaagtatgtgcttaaggtgactcgacagtcccccaactcctatgtagtggtcatgaac
ggctcgtgtgtagaagtagatgtacatcggctgagtgatggaggactgctcctgtcctat
gatggcagcagttataccacgtacatgaaggaggaagtggatagatatcgcatcacgatt
ggcaataaaacatgtgtgtttgagaaggaaaatgacccttcagtgatgcgctcaccttct
gctgggaagttgatccagtacattgtggaggatggaggccatgtgtttgctggccagtgc
tatgctgagattgaggtgatgaagatggtaatgaccttaacagctgcagagtctggctgt
atccattatgtcaaaaggcctggagcagctcttgaccctggttgtgtaatagccaaaatg
cagttggacaaccccagcaaggtccagcaggctgagcttcacacgggtagtctgccacgg
atccacagcacagcactcagaggcgagaagctccatcgagtgttccactatgtcctggat
aatctggtcaacgtaatgaatggatactgccttccagatcctttttttagcagcagggta
aaagactgggtagagcggttgatgaagaccctcagagatccctccttgcctctcctagaa
ttgcaagatatcatgaccagtgtctctggccgtatccccccgaatgtggagaagtctatc
aagaaggaaatggctcagtatgctagcaacatcacatctgtcctctgtcagtttcccagc
cagcagattgccaacatcctagatagtcatgcagctacactgaaccggaaatctgagcgg
gaagtcttcttcatgaacactcagagcattgtccaactggtgcagaggtaccgaagtggc
atccgaggccacatgaaggctgtggtgatggatctgctgcgacagtacctgcgagtggag
acacaattccagaatggtcactatgacaaatgtgtgtttgcccttcgggaggagaacaag
agtgacatgaacactgtactgaattatatcttctctcacgctcaagtcaccaagaagaat
cttctggtcacaatgcttattgtgagtatcnntggccgggaccctactctcactgatgag
ctgctgaatatcctcacagagctaactcaactcagtaagacctccaatgccaaagtggca
cttcgagcacgccaggttcttattgcctcccatttgccatcatatgagcttcgccataac
caagtagagtctatcttcctatcagctattgacatgtatggacatcagttttgcattgag
aacttgcagaaactcatcttgtctgaaacatctatttttgatgtccttccaaacttcttc
tatcacagcaaccaggtagtaaggatggcagctctagaggtgtatgttcgaagggcttat
attgcctatgaacttaacagtgtacaacaccgccagcttaaggacaacacctgcgtggtg
gaattccagttcatgctgcccacatctcatccaaacagagggaacatccccacgctaaac
agaatgtccttctcctccaacctcaaccactatggcatgactcatgtagctagtgtcagc
gatgtgctattggacaactccttcacgccaccatgtcagaggatgggcggaatggtctct
tttcggacttttgaagattttgtcaggatctttgatgaagtgatgggctgcttctgcgat
tccccacctcaaagccccacattccctgaggcaggtcacacatctctgtacgatgaagac
aaggtccccaggaatgaaccaattcatattctgaatgtggctatcaagactgatggtgat
attgaggatgataggctggcagctatgttcagagagtttacccagcaaaagaaatctacc
ctggttgagcatgggatccggcgccttacgttcctggttgcgcaaaaggatttcagaaaa
caggtcaactatgaggtggatcagagatttcatagagagttccctaaatttttcacgttc
cgagcaagggataagtttgaggaggatcgtatctatcgtcacctggagcctgccctagct
ttccagttggagctaaaccgcatgagaaattttgaccttactgccattccatgtgctaat
cacaagatgcacctgtatcttggggcagccaaggtggaagtgggcacagaagtgacagac
tacaggttctttgttcgtgcaatcatcagacattctgatctggtcaccaaggaagcttct
tttgaatatctacaaaatgaaggggagcggctactcctcgaagccatggatgagttggaa
gtcgcttttaacaatacaaatgtccgtactgactgcaaccacatctttctcaactttgtc
cccacggtcatcatggacccatcaaagattgaggaatctgtgcggagcatggtaatgcgc
tatggaagtcggctgtggaaattacgcgtcctccaggcagaactgaaaatcaacattcgc
ctgacaccaactggaaaagcaattcccattcgcctcttccttacaaacgagtctggctat
tacttggacatcagcctgtacaaggaagtgactgactccaggacagcacagatcatgttc
caggcctatggagacaaacagggaccattgcatggaatgttaatcaacactccatatgtg
accaaagacctgcttcaatcaaagagattccaggcacagtccttagggacaacatacata
tatgatatcccagagatgtttcggcagtccctgatcaaactctgggagtctatgtccact
catgcattccttccatcgccccctctgccgtctgacatgctgacgtatactgagctcgta
ctggacgatcaaggtcaactggtccacatgaacaggctgccgggaggaaatgagattggc
atggtagcttggaaaatgacccttaaaagtcctgaatatccagaaggccgagatatcatt
gttattggcaatgatatcacataccgaattgggtcctttgggccccaggaggatttgctg
tttctcagagcttctgagcttgccagagcagagggcatcccccgcatcttcgtagcagct
aacagtggagcaagaattggactggcagaggaaattcgtcatatgtttcacgtggcctgg
gtagatcctgaggatccttacaagggatacaaatatttatatctgacccctcaagattat
aagagagtcagtgctctcaactctgtgcattgtgaacatgtggaggatgaaggagaatcc
aggtacaagataaccgatattattgggaaagaagagggacttggagtagagaaccttcga
agttctggaatgattgcaggagaatcctcattggcctatgatgagatcatcaccatcagc
ctggttacgtgccgggccattgggattggggcttaccttgtccggctgggacagagaacc
atccaggttgaaaactctcacttaattctgacaggagctgccgccctcaacaaagtcctt
gggcgggaagtatatacctccaataaccagctcggaggcatccagatcatgcacaacaat
ggagtgacccacagcaaagtttgtgatgactttgaaggggttttcactgtcctgcactgg
ctgtcttacatgcctaagagtgtgcacagttcagttcctctcctgaactccaaggatcct
atagacagaatcatcgagtttgttcccacaaaggccccatatgatcctcgatggatgcta
gcaggccgtcctcacccaacccagaaaggtcagtggttgagtggattttttgactatgga
tctttctcagagatcatgcaaccctgggcacagaccgtagtggttggcagagccaggcta
ggaggaatacctgtgggagtagttgccgtggaaacccgaacagtggaactaagtatccca
gctgatcctgcaaacctggattctgaagccaagatcatccaacaagctggccaggtttgg
ttcccagactctgcctttaagacctatcaggctatcaaggacttcaaccgtgaagggctg
cctctgatggtctttgccaactggagaggcttctctggtggaatgaaagatatgtatgac
caagtgctgaagtttggtgcttacatcgtggatggcttacgggagtgctctcagcctgtg
atggtttacattcctccccaggccgagcttcggggtggctcctgggtggtgattgacccc
accatcaacccccggcacatggagatgtatgctgaccgagaaagcaggggctcaattttg
gagccagaagggacagtagaaatcaaattccgcagaaaggatctggtgaaaaccatgcgt
cgggtggacccggtctacatccacttggctgagcgattgggcaccccagagctaagtgca
gctgagcggaaggagctggagaacaagttgaaggagcgagaggaattcctgattcccatt
taccatcaggtagctgtgcagtttgctgacttgcacgacacaccaggccggatgcaggag
aagggtattattaatgacatcctggattggaaaacatcccgtaccttcttctactggcgg
ctgaggcgtctcctgttggaggacctggtcaagaagaaaatccacaatgccaaccctgag
ctgactgatggccagatccaggccatgttaaggcgctggtttgtggaagtggaagggaca
gtgaaggcctacgtttgggacaataacaaggatctggtggagtggctggagaaacagcta
acagaggaagatggtgttcgctcagtaatagaggaaaacatcaaatatatcagcagagac
tatgtcctcaagcagatccgcagcttggtacaggccaatccagaggttgccatggattcg
atcatccatatgacccagcacatctcacccactcagagagcagaagttgtacggatcctc
tccacgatggactccccttcgacgtag

DBGET integrated database retrieval system