KEGG   Equus caballus (horse): 100071472Help
Entry
100071472         CDS       T01058                                 

Gene name
ACACA
Definition
acetyl-CoA carboxylase alpha
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ecb  Equus caballus (horse)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100071472 (ACACA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100071472 (ACACA)
   00640 Propanoate metabolism
    100071472 (ACACA)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100071472 (ACACA)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100071472 (ACACA)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100071472 (ACACA)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100071472 (ACACA)
Enzymes [BR:ecb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100071472 (ACACA)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100071472 (ACACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 2288 aa AA seqDB search
MEGSAEENKEMKYYMLQRSSMSGLHIVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVI
EKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPV
PGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMW
ALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFTKRILNVPQELYEKGYVKDVDDGL
KAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHL
EVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYV
SAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRM
MYGLSPWGDAPIDFENSAHVPCARGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVW
GYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLL
ETESFQLNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSISNFLHSLERG
QVLPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVVMNGSCVEVDVHRLSDGGLLLSY
DGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQC
YAEIEVMKMVMTLTAAESGCIHYVKRPGAALDPGCVIAKMQLDNPSKVQQAELHTGSLPR
IHSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLE
LQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSER
EVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENK
SDMNTVLNYIFSHAQVTKKNLLVTMLIVSIXGRDPTLTDELLNILTELTQLSKTSNAKVA
LRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFF
YHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLN
RMSFSSNLNHYGMTHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCD
SPPQSPTFPEAGHTSLYDEDKVPRNEPIHILNVAIKTDGDIEDDRLAAMFREFTQQKKST
LVEHGIRRLTFLVAQKDFRKQVNYEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALA
FQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEAS
FEYLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMR
YGSRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMF
QAYGDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMST
HAFLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPEGRDII
VIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIFVAANSGARIGLAEEIRHMFHVAW
VDPEDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLR
SSGMIAGESSLAYDEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAAALNKVL
GREVYTSNNQLGGIQIMHNNGVTHSKVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKDP
IDRIIEFVPTKAPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARL
GGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGL
PLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDP
TINPRHMEMYADRESRGSILEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSA
AERKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGIINDILDWKTSRTFFYWR
LRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQL
TEEDGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVVRIL
STMDSPST
NT seq 6867 nt NT seq  +upstreamnt  +downstreamnt
atggagggttctgcagaggaaaataaggagatgaaatattacatgcttcaaaggtccagc
atgtctggcttacacatcgtaaagcaaggtcgagaccggaagaaaatagactcacagcga
gatttcactgtagcttctccagcagaattcgttactcgttttggggggaataaagtgatt
gagaaggttcttattgccaacaatggcattgcagcagtgaaatgcatgcgatctatccgt
cggtggtcttatgagatgtttcgaaatgaacgtgcaatccgatttgttgtcatggtcaca
cctgaagaccttaaagccaacgcagaatacattaagatggcagatcactatgtcccagtg
cctggaggaccaaacaacaacaactatgcaaatgtggagttaattcttgatattgctaaa
aggatcccagtacaagcagtgtgggctggctggggtcatgcttctgagaatcccaaactc
ccagaactacttttgaaaaatggcattgccttcatgggtcctccaagccaggccatgtgg
gctttaggggataagattgcatcttccatagtggctcaaactgcaggtatcccaactctt
ccctggagtggcagtggtcttcgtgtggactggcaggaaaatgattttacaaaacgtatc
ttgaatgttccccaggaattatatgaaaaaggttatgtgaaggatgtggatgatgggcta
aaggcagcagaggaagttggatatccggtaatgatcaaggcctcagaaggcgggggaggg
aagggaatcagaaaagtcaacaatgcagatgacttccctaacctcttcagacaggttcaa
gctgaagtccctggatctcctatatttgtgatgagactagccaaacaatctcgtcatctg
gaggtacagatcttagcagatcagtatggcaatgcaatctctttgtttggtcgtgattgc
tctgtacagcgcaggcatcagaagattattgaagaggcacctgctgctattgctactcca
gcagtatttgaacatatggaacagtgtgctgtgaaacttgccaaaatggttggttatgtg
agtgctgggactgtggaatacctctacagccaggatggcagcttctactttctggaactg
aaccctcggctacaggtagagcacccttgtacagagatggtggctgatgtcaacctccct
gcagcacaactccagattgccatgggaatccctctatacagaatcaaggatatccgtatg
atgtatgggttatctccctggggtgatgctcccattgattttgaaaattctgctcacgtt
ccttgcgcaaggggccatgttattgctgctcggatcactagtgaaaatccagatgagggt
tttaagcccagctcaggaacagttcaggaactgaatttccgtagcaataagaatgtttgg
ggttatttcagtgttgctgctgcaggaggacttcatgaatttgctgattctcagtttggt
cactgcttttcctggggagaaaacagagaggaagcaatttcaaacatggtggtggctttg
aaggagctgtctattcggggtgactttcgaactacagttgaatatctgatcaaattgttg
gagactgaaagctttcagttgaatagaattgacactggctggttggacagactgatagcg
gaaaaagtacaggcagagcggcctgacaccatgctgggcgttgtgtgtggggctctccac
gtggcagatgtgagcctgcggaatagcatctctaacttccttcactccttagaaaggggt
caagtccttcctgctcatacccttctgaatacagtagatgttgaacttatctatgaagga
gtcaagtatgtgcttaaggtgactcgacagtcccccaactcctatgtagtggtcatgaac
ggctcgtgtgtagaagtagatgtacatcggctgagtgatggaggactgctcctgtcctat
gatggcagcagttataccacgtacatgaaggaggaagtggatagatatcgcatcacgatt
ggcaataaaacatgtgtgtttgagaaggaaaatgacccttcagtgatgcgctcaccttct
gctgggaagttgatccagtacattgtggaggatggaggccatgtgtttgctggccagtgc
tatgctgagattgaggtgatgaagatggtaatgaccttaacagctgcagagtctggctgt
atccattatgtcaaaaggcctggagcagctcttgaccctggttgtgtaatagccaaaatg
cagttggacaaccccagcaaggtccagcaggctgagcttcacacgggtagtctgccacgg
atccacagcacagcactcagaggcgagaagctccatcgagtgttccactatgtcctggat
aatctggtcaacgtaatgaatggatactgccttccagatcctttttttagcagcagggta
aaagactgggtagagcggttgatgaagaccctcagagatccctccttgcctctcctagaa
ttgcaagatatcatgaccagtgtctctggccgtatccccccgaatgtggagaagtctatc
aagaaggaaatggctcagtatgctagcaacatcacatctgtcctctgtcagtttcccagc
cagcagattgccaacatcctagatagtcatgcagctacactgaaccggaaatctgagcgg
gaagtcttcttcatgaacactcagagcattgtccaactggtgcagaggtaccgaagtggc
atccgaggccacatgaaggctgtggtgatggatctgctgcgacagtacctgcgagtggag
acacaattccagaatggtcactatgacaaatgtgtgtttgcccttcgggaggagaacaag
agtgacatgaacactgtactgaattatatcttctctcacgctcaagtcaccaagaagaat
cttctggtcacaatgcttattgtgagtatcnntggccgggaccctactctcactgatgag
ctgctgaatatcctcacagagctaactcaactcagtaagacctccaatgccaaagtggca
cttcgagcacgccaggttcttattgcctcccatttgccatcatatgagcttcgccataac
caagtagagtctatcttcctatcagctattgacatgtatggacatcagttttgcattgag
aacttgcagaaactcatcttgtctgaaacatctatttttgatgtccttccaaacttcttc
tatcacagcaaccaggtagtaaggatggcagctctagaggtgtatgttcgaagggcttat
attgcctatgaacttaacagtgtacaacaccgccagcttaaggacaacacctgcgtggtg
gaattccagttcatgctgcccacatctcatccaaacagagggaacatccccacgctaaac
agaatgtccttctcctccaacctcaaccactatggcatgactcatgtagctagtgtcagc
gatgtgctattggacaactccttcacgccaccatgtcagaggatgggcggaatggtctct
tttcggacttttgaagattttgtcaggatctttgatgaagtgatgggctgcttctgcgat
tccccacctcaaagccccacattccctgaggcaggtcacacatctctgtacgatgaagac
aaggtccccaggaatgaaccaattcatattctgaatgtggctatcaagactgatggtgat
attgaggatgataggctggcagctatgttcagagagtttacccagcaaaagaaatctacc
ctggttgagcatgggatccggcgccttacgttcctggttgcgcaaaaggatttcagaaaa
caggtcaactatgaggtggatcagagatttcatagagagttccctaaatttttcacgttc
cgagcaagggataagtttgaggaggatcgtatctatcgtcacctggagcctgccctagct
ttccagttggagctaaaccgcatgagaaattttgaccttactgccattccatgtgctaat
cacaagatgcacctgtatcttggggcagccaaggtggaagtgggcacagaagtgacagac
tacaggttctttgttcgtgcaatcatcagacattctgatctggtcaccaaggaagcttct
tttgaatatctacaaaatgaaggggagcggctactcctcgaagccatggatgagttggaa
gtcgcttttaacaatacaaatgtccgtactgactgcaaccacatctttctcaactttgtc
cccacggtcatcatggacccatcaaagattgaggaatctgtgcggagcatggtaatgcgc
tatggaagtcggctgtggaaattacgcgtcctccaggcagaactgaaaatcaacattcgc
ctgacaccaactggaaaagcaattcccattcgcctcttccttacaaacgagtctggctat
tacttggacatcagcctgtacaaggaagtgactgactccaggacagcacagatcatgttc
caggcctatggagacaaacagggaccattgcatggaatgttaatcaacactccatatgtg
accaaagacctgcttcaatcaaagagattccaggcacagtccttagggacaacatacata
tatgatatcccagagatgtttcggcagtccctgatcaaactctgggagtctatgtccact
catgcattccttccatcgccccctctgccgtctgacatgctgacgtatactgagctcgta
ctggacgatcaaggtcaactggtccacatgaacaggctgccgggaggaaatgagattggc
atggtagcttggaaaatgacccttaaaagtcctgaatatccagaaggccgagatatcatt
gttattggcaatgatatcacataccgaattgggtcctttgggccccaggaggatttgctg
tttctcagagcttctgagcttgccagagcagagggcatcccccgcatcttcgtagcagct
aacagtggagcaagaattggactggcagaggaaattcgtcatatgtttcacgtggcctgg
gtagatcctgaggatccttacaagggatacaaatatttatatctgacccctcaagattat
aagagagtcagtgctctcaactctgtgcattgtgaacatgtggaggatgaaggagaatcc
aggtacaagataaccgatattattgggaaagaagagggacttggagtagagaaccttcga
agttctggaatgattgcaggagaatcctcattggcctatgatgagatcatcaccatcagc
ctggttacgtgccgggccattgggattggggcttaccttgtccggctgggacagagaacc
atccaggttgaaaactctcacttaattctgacaggagctgccgccctcaacaaagtcctt
gggcgggaagtatatacctccaataaccagctcggaggcatccagatcatgcacaacaat
ggagtgacccacagcaaagtttgtgatgactttgaaggggttttcactgtcctgcactgg
ctgtcttacatgcctaagagtgtgcacagttcagttcctctcctgaactccaaggatcct
atagacagaatcatcgagtttgttcccacaaaggccccatatgatcctcgatggatgcta
gcaggccgtcctcacccaacccagaaaggtcagtggttgagtggattttttgactatgga
tctttctcagagatcatgcaaccctgggcacagaccgtagtggttggcagagccaggcta
ggaggaatacctgtgggagtagttgccgtggaaacccgaacagtggaactaagtatccca
gctgatcctgcaaacctggattctgaagccaagatcatccaacaagctggccaggtttgg
ttcccagactctgcctttaagacctatcaggctatcaaggacttcaaccgtgaagggctg
cctctgatggtctttgccaactggagaggcttctctggtggaatgaaagatatgtatgac
caagtgctgaagtttggtgcttacatcgtggatggcttacgggagtgctctcagcctgtg
atggtttacattcctccccaggccgagcttcggggtggctcctgggtggtgattgacccc
accatcaacccccggcacatggagatgtatgctgaccgagaaagcaggggctcaattttg
gagccagaagggacagtagaaatcaaattccgcagaaaggatctggtgaaaaccatgcgt
cgggtggacccggtctacatccacttggctgagcgattgggcaccccagagctaagtgca
gctgagcggaaggagctggagaacaagttgaaggagcgagaggaattcctgattcccatt
taccatcaggtagctgtgcagtttgctgacttgcacgacacaccaggccggatgcaggag
aagggtattattaatgacatcctggattggaaaacatcccgtaccttcttctactggcgg
ctgaggcgtctcctgttggaggacctggtcaagaagaaaatccacaatgccaaccctgag
ctgactgatggccagatccaggccatgttaaggcgctggtttgtggaagtggaagggaca
gtgaaggcctacgtttgggacaataacaaggatctggtggagtggctggagaaacagcta
acagaggaagatggtgttcgctcagtaatagaggaaaacatcaaatatatcagcagagac
tatgtcctcaagcagatccgcagcttggtacaggccaatccagaggttgccatggattcg
atcatccatatgacccagcacatctcacccactcagagagcagaagttgtacggatcctc
tccacgatggactccccttcgacgtag

DBGET integrated database retrieval system