KEGG   Equus caballus (horse): 100071559Help
Entry
100071559         CDS       T01058                                 

Gene name
LYPLA2
Definition
lysophospholipase II
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
ecb  Equus caballus (horse)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ecb00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 281 aa AA seqDB search
MAGFPGLERKFRRGRRRGKSVCLCRRKRRIAGEVSKPPGSGGPSRGALQCMCGNTMSVPL
LTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM
VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLY
TALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEK
LRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggctgggttcccgggactcgaacggaagttccggcgggggcggcggagggggaagagt
gtgtgtctgtgccggaggaagaggagaatcgccggagaggtttcgaaacccccagggagt
ggaggccccagccgtggagccttgcagtgtatgtgtggtaacaccatgtctgtgcccctg
ctcactgatgctgccactgtgtctggagctgagcgggaaacggccgcggttattttttta
catggacttggagacacagggcacagctgggctgacgccctctccaccatccggctccct
cacgtcaagtacatctgtccccatgcgcctcggatccctgtgacactgaacatgaagatg
gtgatgccctcctggtttgacctgatggggctgagtccagatgccccagaggacgaggct
ggcatcaagaaggcagcagagaacatcaaggccttgattgagcacgagatgaagaatggg
atccctgccaatcgtattgtcctgggaggcttttcacagggtggggccctgtccctctac
acggccctcacctgcccccaccctctggctggcattgtggcattgagctgttggctgcct
ctgcaccgggccttcccccaggcagccaacggcagtgccaaggacctggccatccttcag
tgccatggggagctggaccccatggttcctgtacgatttggggccctgacggctgaaaaa
ctccggtccgttgtcacacccgccagggtccaattcaagacttacccaggtgtcatgcac
agctcctgtcctcaggagatggcagccgtgaaggagtttctcgagaagctgctgcctcct
gtctaa

DBGET integrated database retrieval system