KEGG   Equus caballus (horse): 100071559Help
Entry
100071559         CDS       T01058                                 

Gene name
LYPLA2
Definition
lysophospholipase II
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
ecb  Equus caballus (horse)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100071559 (LYPLA2)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100071559 (LYPLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 281 aa AA seqDB search
MAGFPGLERKFRRGRRRGKSVCLCRRKRRIAGEVSKPPGSGGPSRGALQCMCGNTMSVPL
LTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM
VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLY
TALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEK
LRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggctgggttcccgggactcgaacggaagttccggcgggggcggcggagggggaagagt
gtgtgtctgtgccggaggaagaggagaatcgccggagaggtttcgaaacccccagggagt
ggaggccccagccgtggagccttgcagtgtatgtgtggtaacaccatgtctgtgcccctg
ctcactgatgctgccactgtgtctggagctgagcgggaaacggccgcggttattttttta
catggacttggagacacagggcacagctgggctgacgccctctccaccatccggctccct
cacgtcaagtacatctgtccccatgcgcctcggatccctgtgacactgaacatgaagatg
gtgatgccctcctggtttgacctgatggggctgagtccagatgccccagaggacgaggct
ggcatcaagaaggcagcagagaacatcaaggccttgattgagcacgagatgaagaatggg
atccctgccaatcgtattgtcctgggaggcttttcacagggtggggccctgtccctctac
acggccctcacctgcccccaccctctggctggcattgtggcattgagctgttggctgcct
ctgcaccgggccttcccccaggcagccaacggcagtgccaaggacctggccatccttcag
tgccatggggagctggaccccatggttcctgtacgatttggggccctgacggctgaaaaa
ctccggtccgttgtcacacccgccagggtccaattcaagacttacccaggtgtcatgcac
agctcctgtcctcaggagatggcagccgtgaaggagtttctcgagaagctgctgcctcct
gtctaa

DBGET integrated database retrieval system