KEGG   Equus caballus (horse): 100071760Help
Entry
100071760         CDS       T01058                                 

Gene name
FLNC
Definition
(RefSeq) filamin C, gamma
  KO
K04437  
filamin
Organism
ecb  Equus caballus (horse)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100071760 (FLNC)
 Cellular Processes
  Cellular community
   04510 Focal adhesion
    100071760 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100071760 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    100071760 (FLNC)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100071760 (FLNC)
  Intermediate filaments
   Intermediate filament-binding proteins
    100071760 (FLNC)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100071760 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 2762 aa AA seqDB search
MVFIHFTLATSWLRIYVVESTGRSPTTEDHWFDLDLEAKMEVTVWKDPGGKPPRGKEDSS
RITFTRRCNEHLTCVVKRLTDLQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLE
NVSVALEFLEREHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARK
QTPKQRLLGWIQNKVPQLPITNFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENA
REAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKA
IAYGPGIEPQGNTVLQPAHFTVQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAV
SYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYF
DIYTAGAGTGDVAVVIVDPQGRRDTVEVALEDKGDSTFRCTYRPVMEGPHTVHVAFAGAP
ITRSPFPVHVAEEPLPPLAPSVPIVHQAKRVVPPCNPNACRASGRGLQPKGVRVKEVADF
KVFTKGAGSGELKVTVKGPKGTEELVKVREAGDGVFECEYYPVVPGKYVVTITWGGYAIP
RSPFEVQVSPEAGAQKVRAWGPGLETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIE
CDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQPAPPDCFPDKVKAFGPGL
EPTGCIVDKPAEFTIDASAAGKGDLKLYAQDADGCPIDINVFTTGNGIFRCSYVPTKPIK
HTIIISWGGVNVPKSPFRVNVGEGSHPEKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQG
DVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFANQEIPASPF
HIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKAKLDVHFAGAGKGEAVRD
FEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNVAPPLDLSKVKVQGLNSK
VAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYK
VDITYDGHPVPGSPFTVEGVLPPDPSKVCAYGPGLKGGLVGSPAPFSIDTKGAGTGGLGL
TVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHIPGSPFKATIRPVFDPSK
VRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVKAEVLIHNNADGTYHITYS
PAFPGTYTITIKYGGHPVPKFPTRVHVQPAIDTSGVKVSGPGVEPHGVLREVTTEFTVDA
RSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDDVAVPK
SPFRVGVTEGCDPTRVRAYGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSC
KDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDVVDPGKVKCSGPGLGAGV
RARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEIRDNGDGTHAVHYTPATDGPYTVAV
KYADQEVPRSPFKIKVLPAHDASKVRASGPGLNAAGIPASLPVEFTIDARDAGEGLLTVQ
ILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDAS
KCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVTCTVSTPDGAELDVDVVEN
HDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPMPHVEEPSDVLQLHRPSAYP
THWATEEPVVPVEPMESMLRPFNLVIPFTVQKGELTGEVRMPSGKTARPNITDNKDGTIT
VRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIV
TKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFT
AKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGI
SFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGQTFQVAEFI
VDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVPGSP
FTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSH
TYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEG
EASSQDMTAQVTSPSGKTEAAEIVEGEDSAYSVRFVPQEMGPHTVTVKYRGQHVPGSPFQ
FTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFED
RKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTSLQETGLKV
NQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFN
GAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTID
GPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLSGGHSL
HETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKA
GTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVN
VP
NT seq 8289 nt NT seq  +upstreamnt  +downstreamnt
atggtttttatccactttactctggccaccagttggctgagaatatatgtggtggaaagt
actggaagatcacctaccactgaggatcactggtttgacttggatttagaagccaagatg
gaggtcacagtctggaaagaccctggcggaaagccgccccgtgggaaggaagattccagc
agaatcacgttcacgcgccggtgcaacgagcacctcacgtgcgtggtcaagcgcctgacc
gacctgcagcgagacctcagcgacgggctacgcctcatcgcgctgctcgaggtactcagc
cagaagcgcatgtatcgcaagttccacccgcgtcccaacttccgtcagatgaagctggag
aacgtgtccgtggccctcgagttcctcgagcgcgagcacatcaagcttgtgtccatcgac
agcaaggccatcgtggatgggaacctgaagctgatcctggggctgatctggacgttgatc
ctgcactactccatctccatgcccatgtgggaagatgaggatgatgaagatgcccgcaaa
cagacgcccaagcagcgtctgcttggctggatccagaacaaggtgccccagctgcccatc
actaacttcaaccgcgactggcaggatggcaaagctctgggtgccctggtggacaactgt
gcccctggcctctgccctgactgggaggcctgggatcccaaccagcctgtggagaacgcc
cgggaggccatgcagcaggcggacgactggctcggggtgccccaggtgattgcccccgag
gagattgtggaccccaatgtagatgagcattctgtcatgacctacctgtcccagttcccc
aaggccaagctcaaacctggtgcccctgttcgctccaagcagctgaaccccaagaaggcc
attgcctatgggcctggcattgagccccagggcaacaccgtgctgcagcctgcccacttc
accgtgcagaccgtggatgccggtgtgggcgaggtgctggtctacattgaggatcctgag
ggccacaccgaggaggccaaggtggttcccaacaatgacaaggaccgcacctatgctgtc
tcctacgtgcctaaggttgctgggttgcacaaggtgactgtgctctttgctggccagaac
atcgaacgcagcccctttgaggtgaatgtgggcatggcccttggggatgccaacaaggtg
tcagcccgtggccctggcctggagcctgtgggcaatgtggccaacaaacctacctacttt
gacatctacactgcaggggccggcactggtgatgttgccgtggtgatcgtggacccgcag
ggccggcgggacacagtggaggtggccctggaggacaagggcgacagcacgttccgctgc
acatacaggcctgtgatggaggggccccacacagtgcatgtggccttcgctggtgccccc
atcacccgcagtcctttccccgtccatgtggcagaagagcccttgccaccgctcgcccct
tccgtgcccatcgtccaccaggccaagagagtggtgccaccctgtaaccccaatgcctgc
cgcgcctctgggcggggcctgcagcccaagggtgtgcgggtgaaagaggtggctgacttc
aaggtgttcaccaagggcgctggcagcggagagctcaaggtcacagtcaaggggccaaag
ggcacagaggagctggtgaaggtgcgagaggctggggacggtgtgttcgagtgtgagtac
taccctgtggtgcctgggaagtatgtggtgaccatcacgtggggcggctatgccatcccc
cgcagtccctttgaggtacaggtgagcccagaggcaggagcgcagaaggtacgggcctgg
gggcctggtttggaaactggccaggtgggcaagtcagctgactttgtggtggaggccatt
ggcacggaggtggggacactgggcttctccattgaggggccttcacaggccaagatcgag
tgtgatgacaagggggatggctcctgcgatgtacggtactggcccactgagcccggggag
tacgccgtgcatgtcatctgcgatgatgaggacatccgagactcgcccttcattgcccac
atccagccagccccacctgactgcttcccggacaaggtgaaggcctttgggcctggcctg
gagcccactggctgcatcgtggacaagcctgcggagttcaccattgatgcctctgcagct
ggcaagggagacctgaagctctatgcccaggacgccgacggctgccctatcgacatcaac
gtcttcaccactggcaacggcatcttccgctgctcctacgtgcccaccaagcccattaaa
cacaccatcatcatctcttggggaggtgtcaacgtgcccaagagccccttccgggtaaac
gtgggagagggcagtcaccctgagaaagtgaaggtgtacggccctggcgtggagaagacg
ggcctcaaggccaacgagcccacctatttcaccgtggactgcagcgaggcggggcaaggc
gatgtgagcattggcatcaagtgcgcccccggcgtggtgggccccgcagaggctgacatt
gactttgacatcatcaagaatgacaatgacaccttcacagtcaagtacacacccccaggg
gccggccgctacaccatcatggtgctgtttgccaaccaggagatccctgccagccccttc
cacatcaaggtggacccatcccatgatgccagcaaggtcaaggctgagggccctgggctg
aaccgcacaggtgtagaagttgggaagcccactcacttcacggtgctgaccaagggagct
ggcaaggctaagctggacgtgcactttgccggggccggcaagggtgaggctgtgcgggac
tttgagatcatcgacaaccacgactactcctataccgtcaagtacaccgccgtccagcag
ggcaacatggcagtgacagtgacctatggtggggaccccgtccccaagagtccctttgtg
gtgaatgtggcacctccgctggacctcagcaaagtcaaagttcaaggcctcaacagtaag
gtggctgtggggcaagaacaggcattctctgtgaacacacgaggggctggtggtcagggc
cagctggatgtgcggatgacctcaccctcccgacgaccgatcccctgcaagctggagcct
gggggcggagctgaagcccaggctgtgcgctacatgcctcctgaggagggtccctacaag
gtggacattacctacgacggccacccggtacctggcagccccttcactgtggagggtgtc
ctgccccccgacccctccaaggtttgtgcttatggccctggtctcaagggtgggctggta
ggcagcccagcgccgttctccatcgacaccaagggggctggcaccggtggcctggggctg
actgtggagggcccctgtgaggccaagatcgagtgccaggacaatggtgatggctcatgt
gcggtcagctacctgcccacggagccgggcgagtacaccatcaacatcctgttcgccgaa
gcccacatccccggctcacccttcaaggctaccatccggcccgtgttcgacccgagcaag
gtgcgggccagtgggccaggcctggagcgtggcaaggctggtgaggcagccaccttcact
gtggactgctcggaggcgggcgaggctgagctgaccatcgagatcctgtcagacgctggc
gtcaaggccgaggtgctgatccacaacaatgctgacggcacctaccacatcacctacagc
cccgccttccccggcacctacactattaccatcaagtacggtgggcaccccgtacccaaa
ttccccacccgcgtccatgtgcagcccgctatcgacaccagtggagtcaaggtctcgggg
cctggtgtggagccgcacggtgtcctgcgtgaggtgaccactgagttcactgtggatgca
agatccctaacagccacaggtgggaaccatgtgacggctcgtgtgctcaacccctcgggt
gctaagacggacacctacgtgacggacaacggggatggcacctaccgagtgcaatacaca
gcctatgaagagggcgtacatttggtggaggtgctgtatgatgacgtagctgtgcccaag
agtcccttccgagtgggtgtgaccgagggctgtgaccccacgcgtgttcgggcctatgga
ccaggcctggagggtggcttggtcaacaaggccaaccgcttcactgtggagaccagggga
gcaggcactgggggcctaggcctagccatcgagggcccctcggaagccaagatgtcctgc
aaagacaacaaggatggcagctgcaccgtagagtacatccccttcacccctggagactat
gacgtcaatatcacctttggggggcggcccatcccagggagcccgttccgggtgccagtg
aaggatgtggtggaccccgggaaagtgaaatgctcaggaccagggctgggggccggtgtc
agggcccgggtaccccagaccttcacggtggactgcagccaggctggccgggcccccctg
caggtggctgtgctgggccccacaggtgtggctgagcctgtggagatacgtgacaatgga
gatggcacccatgctgtccactacaccccggccactgatggtccatacacggtagccgtc
aagtatgccgaccaggaagtgccacgcagccccttcaagatcaaggtgcttccagcccat
gatgccagcaaggtgcgggccagtggccctggcctcaacgccgctggcatccctgccagt
ctgcctgtggagttcaccatcgatgcccgggatgctggtgagggcttgcttaccgtccag
atcctggaccccgagggtaagcccaagaaggccaacatccgagacaatggggatggcaca
tacaccgtgtcctacctgccagacatgagtggccggtacaccatcaccatcaagtacggc
ggtgacgagatcccctactcacccttccgcatccatgccctgcccactggggacgccagc
aagtgcctcgtcacagtgtccattggaggccatggcctgggtgcctgcctaggcccccgc
atccagatcggggaggagacggtgatcacagtggacgccaaggcagcaggcaaggggaag
gtaacatgcacagtgtccacgccggatggggcagagctcgacgtggacgtggttgagaac
catgacggtacctttgacatctactacacagcgcccgagccgggcaagtacgtcatcacc
atccgctttggaggcgagcacatccccaacagtcccttccatgtgctggcgtgtgacccc
atgccccacgtggaggagccctctgacgtgttgcagctgcaccggcccagcgcctacccc
acacactgggccacagaggagccagtggtgcctgtggagccaatggagtctatgttgagg
cccttcaacctggtcatccccttcaccgtgcagaaaggggagctcacaggggaggtacgg
atgccctctgggaaaactgcccggcccaatatcaccgacaacaaggatggcaccatcaca
gtgaggtacgcgcccactgagaaaggcctgcaccagatggggatcaagtatgatggcaac
cacatccctgggagccccctgcagttctatgtggatgccatcaacagccgccatgtcagt
gcctacgggccaggcctgagccatggcatggtcaacaagccggccaccttcaccattgtc
accaaggatgctggggaagggggtctgtcactggccgtggagggcccgtccaaagcagag
atcacctgcaaggacaacaaggatggcacctgcacggtgtcctacctacccacagcgcct
ggagactacagcatcatcgtgcgctttgatgacaagcacatcccggggagccccttcaca
gccaagatcacaggcgatgactcgatgaggacgtcacagctaaacgtgggcacctccacg
gatgtgtcactgaagatcaccgagagtgacctgagcctgctgaccgccagcatccgtgcc
ccctcgggcaacgaggagccctgcctgctgaagcgcctgcccaaccggcacattggcatc
tccttcacccccaaggaagttggggagcatgtggtgagcgtgcgcaagagtgggaagcac
gtcaccaatagccccttcaagatcctggtggggccttctgagatcggggacgctagcaag
gtgcgggtctggggcaagggcctgtccgagggacaaaccttccaggtggcggagttcatc
gtggacactcgtaatgcaggttatgggggcctggggctgagtattgaaggccctagcaag
gtggacatcaactgtgaggacatggaggatggcacatgcaaagtcacctactgccccact
gaacccggcacctacatcatcaacatcaagtttgctgacaagcatgtgccaggaagcccc
ttcactgtgaaggttaccggtgagggccgcatgaaggaaagcatcacccggcgcaggcag
gcaccttccatcgccaccattggcagcacctgtgacctcaacctcaagatcccagggaac
tggttccagatggtgtctgcccaggagcgcctgacacgcaccttcacgcgcagcagccac
acgtacacccgcacagagcgcacggagatcagcaagacccggggcggagagaccaagcgt
gaggtgcgggtggaggagtccacccaggttggcggagaccccttccccgcggtcttcggg
gacttcctgggccgcgaacgcctgggctcctttggcagcatcactcggcagcaggagggt
gaggccagctctcaagacatgaccgcacaggtgaccagcccatcgggcaagacagaagcc
gcagagatcgtcgagggggaggacagtgcatacagcgtgcgctttgtgccccaggagatg
gggccccatactgtcactgtcaagtaccgtggccagcacgtgcccggcagcccctttcag
ttcactgtggggccactgggtgaaggtggtgcccacaaggtgcgggctggaggcacaggg
ctggagcgaggtgtggctggcgtgccagctgagttcagcatctggacccgagaagcaggt
gccgggggcctgtcgattgctgtggagggtcccagcaaggcagagattgcatttgaggac
cgcaaagacggctcctgtggggtctcctatgttgtccaggaaccaggtgactatgaggtc
tccatcaagttcaatgatgagcacatcccagacagcccctttgtggtgcctgtggcctcc
ctctcagacgatgctcgccgcctcactgtcaccagcctccaggagacggggctcaaggtg
aaccagccagcgtcctttgcggtgcagctgaatggtgcgcggggcgtgatcgatgctagg
gtgcacacgccctcgggtgcggtggaggagtgctacgtctccgagctggacagtgacaag
cacaccatccgcttcatcccccacgagaatggcgtccactccatcgatgtcaagttcaac
ggtgcccacatccctggcagtcccttcaagatccgtgttggggagcagagccaagctggg
gacccaggcttggtgtcagcctatggtcccgggctggagggaggcactacaggtgtatca
tcagagttcattgtcaacaccctgaacgcgggctcaggggccttgtctgtcaccatcgat
ggcccctccaaggtgcagctggactgtcgggaatgtcctgagggccacgtggtcacttac
actcccatggcccctggcaactacctcatcgccatcaagtatggtggcccgcagcacatc
gtgggcagccccttcaaggccaaagtcacaggtccccggctatcgggaggccacagcctt
cacgaaacatccacggttctggtggagactgtgaccaagtcatcctcaagccggggctcc
agctacagctccatccccaagttctcctcggatgccagcaaggtggtgacgcggggcccc
gggctgtcccaggcctttgtgggccagaagaactccttcaccgtggactgcagcaaagca
ggcaccaacatgatgatggtgggtgtgcacgggcccaagaccccctgtgaggaggtgtat
gtgaagcacatggggaaccgggtgtacaacgtcacctacaccgtcaaggagaaaggagac
tacatcctcatcgtcaagtggggcgacgaaagtgtccccggaagccccttcaaagtcaat
gtgccctga

DBGET integrated database retrieval system