KEGG   Equus caballus (horse): 100071872Help
Entry
100071872         CDS       T01058                                 

Gene name
PRKG1
Definition
protein kinase, cGMP-dependent, type I
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
ecb  Equus caballus (horse)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Module
cGMP signaling
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100071872 (PRKG1)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100071872 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100071872 (PRKG1)
  Digestive system
   04970 Salivary secretion
    100071872 (PRKG1)
  Nervous system
   04730 Long-term depression
    100071872 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    100071872 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    100071872 (PRKG1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100071872 (PRKG1)
Protein kinases [BR:ecb01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100071872 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 686 aa AA seqDB search
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQA
QKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMK
NLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKV
FGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSL
PEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGKVNVTREDSPSEDPVFLRTLG
KGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKY
EAEAAFFANLKLSDFNVIDTLGVGGFGRVELVQLKSEESKTFAMKILKKYHIVNTRQQEH
IRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEVCLGGELWTILRDRGSFEDSTTRFYT
ACVVEAFAYLHSKGIIYRDLKPENLILDHRGYTKLVDFGFAKKIGFGKKTWTFCGTPEYV
APEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAK
NAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTD
TSNFDSFPEDNDEPPPDDNSGWDIDF
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccctgcgggatttacagtacgcgcttcaggagaagatcgaggagctgaggcag
cgggatgctctcatcgacgagctggagctagagttggatcagaaggacgaactgatccag
aagctgcagaacgagctggacaagtaccgctcggtgatccggccggccacccagcaggcg
cagaagcagagcgcgagcaccttgcagggcgagccgcgcaccaagcggcaggcgatctcc
gctgagcccaccgctttcgacatccaggatctcagccatgtgaccctgcccttctacccc
aagagcccacagtctaaggatctcataaaggaagccatccttgacaatgactttatgaag
aacctggagctgtcgcagatccaggagattgtggattgtatgtacccggtggagtacggc
aaagacagttgcatcatcaaagaaggagatgtgggatcactggtgtatgtcatggaagat
ggtaaggttgaagttacaaaagaaggtgtgaagctatgcaccatgggtccaggaaaagtt
tttggggagctggctattctttacaactgtactcggacagcgaccgtcaagactcttgta
aatgtgaaactctgggccattgatcgacaatgttttcaaacaataatgatgaggacagga
ctgatcaagcataccgagtatatggaatttttaaaaagcgtaccaacattccagagcctt
cctgaagaaatcctcagtaagcttgctgacgtccttgaagagacccactatgaaaatggg
gaatatatcatcaggcaaggtgccagaggggacaccttctttatcatcagcaaaggaaag
gtaaatgtcactcgtgaagactcaccaagtgaagacccagtgtttcttagaactctagga
aaaggagattggtttggagagaaagctttgcaaggggaagatgtgagaacagcaaatgta
attgctgcagaagctgtaacctgccttgtgatcgacagagactcttttaagcatttgatc
ggaggactggatgatgtttctaataaggcatatgaggatgcagaagctaaagcaaaatat
gaagctgaagctgctttcttcgccaacctgaagctgtctgatttcaacgtcattgatacc
ctcggagttggaggtttcggacgagtagaactggtccagttgaaaagtgaagaatccaaa
acgtttgccatgaagattctcaagaaataccacattgtgaatacaagacagcaggagcac
atccgctcggagaagcagatcatgcagggggcccattccgacttcatagtgagactatac
agaacgtttaaggacagcaaatatttgtatatgttgatggaagtttgcctgggtggagag
ctctggaccattctcagggatagaggttcatttgaagattctacaaccagattttacacg
gcatgtgtggtagaagcgtttgcctatctgcattccaaaggaatcatttacagggacctc
aagccagaaaatctcatcctagatcaccgaggttacaccaaactggttgattttggcttt
gcaaagaaaataggatttggaaagaaaacatggactttttgtgggactccagagtatgta
gccccagagatcatcctgaacaaaggccatgacatttcagccgactattggtcactggga
atcctaatgtatgaacttctgactggcagcccgcctttctcaggcccagatcctatgaag
acctataacatcatactgagggggattgatatgatagagtttccaaagaagattgccaaa
aatgctgctaatttaattaaaaaactatgcagggacaacccgtcagaaagattagggaat
ttgaaaaatggagtgaaagacattcaaaagcacaagtggtttgagggctttaattgggaa
ggcttaagaaaaggcaccttgacgcctccgataataccaagtgttgcatcacccacagac
acaagcaatttcgacagtttccctgaggacaatgacgaaccaccacctgatgacaactca
ggatgggatatagacttctaa

DBGET integrated database retrieval system