KEGG   Equus caballus (horse): 100071930Help
Entry
100071930         CDS       T01058                                 

Gene name
PTPN5
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
  KO
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
ecb  Equus caballus (horse)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100071930 (PTPN5)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100071930 (PTPN5)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100071930 (PTPN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 609 aa AA seqDB search
MGIEHCFHQSLKARRAESLGIWALRGRSAIPSCVAWGGSLHFSESPLSPLEDTGVQGNHA
ADDSEGGALDMCCSERLPGLPEPGVMEALDQAEGLTDSQREMPPPPPPSPPSEPAQEPPP
PGAGSHSLTVRSSLCLLAASQVLLACGMLWLSGYCPLWSQNATDLLSSLLALLEQLGPTA
WLGIGTWDIPSLLLVSLTVVLVTTLVWHLLRAPPEPSAPLPPEDRRQSVSRQPSFTYSEW
MEEKVEDDFLDLDPVPETPVFDCTMDIKPEADPASLTVKSMGLQERRGSNVSLTLDMCTP
GCNEEGFGYLMSPREESAREYLLSASRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKE
YDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPI
VSTVGDFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVVYDGVEITVRKVVHTEDYR
LRLISLRSGTEERDLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHGAPIVVHC
SAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTWDHYNFVHHFMSLYE
NKLSPQGPE
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgggaattgagcactgttttcaccaaagcctgaaggccagaagagcagagagcttagga
atatgggcactgaggggcagatctgccattcctagctgcgtggcctggggcgggtcactt
cacttctctgagtctccattgtctcctctagaagatacaggagtgcaagggaaccacgct
gctgatgactccgagggaggggccctggacatgtgctgcagcgagaggctgccgggtctc
cccgagccgggagtgatggaggcgctggaccaggccgaggggctcaccgactcacagaga
gagatgccgccgcccccacctccttcaccgccctcagagccagctcaggagccgccacct
ccaggggccgggagccactccctcactgtcaggagcagcctgtgcctgttggctgcctct
caggtcctgcttgcctgcgggatgctctggctcagtggctactgcccgctctggtcgcag
aacgccacagacctcctctcctccttgctggcgctcctggaacagctgggacccacggcc
tggctgggcattgggacctgggacatccccagtctgctgctagtctctctgaccgtggtc
cttgtcactaccctggtgtggcacctcctgagggctcccccagagccttctgccccgctg
ccccccgaggacaggcgccagtcggtgagccgccagccctccttcacttactcggagtgg
atggaagagaaggtcgaggatgacttcctggacctggaccctgtccccgagactcctgtg
tttgactgcacaatggacatcaagcctgaggccgaccccgcctcactgaccgtcaagtcc
atgggtctgcaggagaggaggggctccaacgtctccctgaccctggacatgtgcaccccg
ggctgcaatgaggagggcttcggctacctcatgtccccacgcgaggagtcagcccgcgag
tacctgctcagcgcctcccgtgtcctccaggccgaggagctgcacgaaaaggccctggac
cccttcctgctgcaggcggagttctttgaaatccccatgaactttgtggatccaaaagag
tatgacatccctgggctggtgcggaagaatcggtacaaaaccatccttcccaaccctcac
agcagagtctgcctgacctcaccagaccctgacgaccctctgagttcctacatcaacgcc
aactacatccggggctatggtggggaggagaaggtgtacattgccactcagggacccatc
gtcagcacggtcggcgacttctggcgcatggtgtggcaggagcacacgcccatcattgtc
atgatcaccaatatcgaggagatgaacgagaagtgcaccgagtactggccggaggagcag
gtggtgtacgacggggtcgagatcaccgtgcggaaggtcgttcacactgaggattaccgg
ctgcgacttatctccctcaggagcgggaccgaggagcgagacctgaagcattactggttc
acgtcctggcctgaccagaagaccccagaccgggcccccccgctcctgcacctggtgcgg
gaggtggaggaggcagcccagcaggaggggccccacggtgcccccatcgtcgtccactgc
agcgcaggcattgggaggaccggctgcttcattgccaccagcatctgctgccagcagctg
cggcaggagggtgtggtggacatcctgaagaccacgtgccagctccgtcaggacaggggc
ggcatgatccagacgtgggaccattacaatttcgtccaccacttcatgagcctttacgag
aacaagttgtccccccagggcccagagtga

DBGET integrated database retrieval system