KEGG   Equus caballus (horse): 100072358Help
Entry
100072358         CDS       T01058                                 

Gene name
PDIA6
Definition
protein disulfide isomerase family A, member 6
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ecb  Equus caballus (horse)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100072358 (PDIA6)
Enzymes [BR:ecb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100072358 (PDIA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
15
AA seq 448 aa AA seqDB search
MKPAINGVLFVVSPGLMSCTLFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYA
PWCGHCQRLTPEWKKVATALKDVVKVGAVDADKHQSLGGQYGVQGFPTIKIFGANKNRPE
DYQGGRSGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSESSSKKDVIELTDDSFDK
NVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQVLASRY
GIRGFPTIKIFQKGESPVDYDGGRTRSDIISRALDLFSDNAPPPELLEIINEDIAKKTCE
EHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIG
GFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPAISTREPW
DGKDGELPVEDDIDLSDVELDDLEKDEL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgccattaatggtgtgctttttgttgtttctccaggtctgatgagctgcacc
ttgtttctagcagtgaatggtctgtattcctctagtgatgatgtaatcgaattaactcca
tcaaatttcaaccgagaagttattcaaagtgatagtttgtggcttgtagaattctatgct
ccgtggtgtggccactgccaaagattaaccccagaatggaaaaaagtagccactgcgtta
aaagatgttgtaaaagttggtgcagttgatgcagataaacatcagtccctaggaggtcaa
tacggtgttcagggatttcctaccattaagatttttggagccaacaaaaacagaccagaa
gattatcagggtggcagaagtggcgaggccattgtagatgctgctctcagtgctctgcgc
cagctcgtcaaggatcgccttgggggaaggagcggtggatatagttctggaaaacagggt
agaagcgaaagctcaagtaagaaagatgtgattgagctgacggatgacagctttgataag
aacgtccttgacagtgaagatgtttggatggtggagttttatgctccttggtgtggacac
tgtaaaaacctggagccagaatgggcagctgcagctacagaggtcaaagagcaaacgaaa
gggaaagtgaaactcgcagctgtggatgctaccgtcaaccaggtgctggccagccgctac
gggattaggggatttcctacaatcaagatatttcagaagggcgagtctcctgtggattat
gatggggggcggacaagatcagacatcatttcacgggccctcgatttgttttctgataac
gccccacctcctgagctgcttgagatcatcaacgaggacatcgccaagaagacatgtgag
gagcatcagctctgtgtcgtggctgtgctgccccatattcttgatactggagctgcaggc
agaaattcttatttggaagttcttctgaagttggcagacaaatacaaaaagaaaatgtgg
gggtggctgtggacagaagctggagcccagtctgagctcgagactgcactgggcattggc
gggtttggataccccgccatggcagccattaatgcgcgcaagatgaaatttgcccttctg
aaaggatctttcagtgagcaaggcattaacgagtttctcagggagctctccttcgggcgc
ggatccacagcccctgtgggaggtggggcgttccctgccatcagcaccagagagccttgg
gacggcaaagatggcgagcttcccgtggaagacgacattgacctcagcgacgtggagctc
gacgacttagagaaggatgagttgtga

DBGET integrated database retrieval system