KEGG   Equus caballus (horse): 100072578Help
Entry
100072578         CDS       T01058                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04110  Cell cycle
ecb04213  Longevity regulating pathway - multiple species
ecb04330  Notch signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb05016  Huntington's disease
ecb05034  Alcoholism
ecb05165  Human papillomavirus infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05203  Viral carcinogenesis
ecb05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100072578 (HDAC2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100072578 (HDAC2)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100072578 (HDAC2)
  Aging
   04213 Longevity regulating pathway - multiple species
    100072578 (HDAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100072578 (HDAC2)
   05202 Transcriptional misregulation in cancers
    100072578 (HDAC2)
   05203 Viral carcinogenesis
    100072578 (HDAC2)
   05220 Chronic myeloid leukemia
    100072578 (HDAC2)
  Neurodegenerative diseases
   05016 Huntington's disease
    100072578 (HDAC2)
  Substance dependence
   05034 Alcoholism
    100072578 (HDAC2)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100072578 (HDAC2)
   05165 Human papillomavirus infection
    100072578 (HDAC2)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100072578 (HDAC2)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100072578 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     100072578 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100072578 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    100072578 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100072578
NCBI-ProteinID: XP_023506728
Position
10
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKDTEDKKTDVKEEDKSKDNSGEKTDTKGA
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcagggaggtggcaagaagaaagtctgctactactacgatggtgatatt
ggaaattattattatggacagggtcatcccatgaaacctcatagaatccgcatgacccat
aacttgctgctaaattatggcttatatagaaaaatggaaatatacaggccccataaagcc
actgctgaagaaatgacaaaataccacagtgatgagtacatcaaatttctccgttcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgttggagaggat
tgtccagtgtttgatggactctttgagttttgtcagctttccactggtggctcagttgct
ggggctgtgaagttaaaccgacaacaaactgatatggctgttaattgggctggaggatta
catcacgctaagaaatcagaagcgtcggggttctgttatgttaatgatattgtgcttgcc
atccttgagttactaaagtatcatcagagagtcttatatattgatattgatattcatcat
ggtgatggtgttgaagaagctttttatacaacagatcgtgttatgactgtatcattccat
aaatatggggaatactttcctggaacaggagacttaagggatattggtgcaggaaaaggc
aaatactatgctgtgaattttccaatgagagatggcatagatgatgagtcatatgggcag
atatttaagcctattatctcgaaagtgatggagatgtaccagcccagtgcggtggtgctg
cagtgcggcgccgactcgctgtccggggacaggctgggctgcttcaatctcacggtcaaa
ggtcatgctaaatgtgtagaagttgtaaaaactttcaatttaccgttgctgatgcttggg
ggaggaggatacacaatccgtaatgttgctcgatgttggacgtatgagactgcagttgcc
cttgattgtgagattcccaatgaattgccatataatgattactttgagtattttggaccg
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatttacgcatgttaccacatgcacctggtgtc
caaatgcaagctattccagaagatgctgttcatgaagacagtggagatgaagacggagaa
gatccagacaagagaatttctattcgggcatcagacaagcggatagcttgtgatgaagaa
ttctcagattctgaggacgaaggagaaggaggtcgtagaaatgtggctgatcataagaaa
ggagcaaagaaagctagaattgaggaagacaagaaagacacagaggacaaaaaaacagat
gttaaggaagaagataaatccaaggacaatagtggtgaaaaaacagataccaaaggagcc
aaatcagaacagctcagcaacccttga

DBGET integrated database retrieval system