KEGG   Equus caballus (horse): 100072744Help
Entry
100072744         CDS       T01058                                 

Gene name
PRF1
Definition
(RefSeq) perforin 1 (pore forming protein)
  KO
K07818  
perforin 1
Organism
ecb  Equus caballus (horse)
Pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100072744 (PRF1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100072744 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    100072744 (PRF1)
   05330 Allograft rejection
    100072744 (PRF1)
   05332 Graft-versus-host disease
    100072744 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    100072744 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100072744 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 555 aa AA seqDB search
MAARELLLGLLLLLLPTPAPAPCHTAARSECRRKRPFVPGSWLAGEGVDVTSLRRSGSFP
VDTQHFLRPDGTCTLCRNALQQDALQRLPLALTDWRAQGSGCRRHVVRAKGSSTEAVARE
AAGSIRNDWQVGLEVTPKPSANARVTVAGSHSKAADFAAQKTYQDQYSFSSDSVECRFYS
FRLVHAPPLHPDFKRALRALPPHFNASTEPDYLRLISNYGTHFIRSMELGGRLSALTALR
TCMLALEGLTADEVADCLAVEAEVNIGGLGSSSSQYKACEEKKQQHKLGTSFHQAYRERI
SEVVGGHHSSMHDLLFANQAEPEQFSAWVASLQDRPGLVDYSLEPLHMLLESQEPRREAL
RQAVSKYLRDKARWRDCSRPCPPGQQKSPHDPCQCVCHGSAVTSHDCCPRRRGMARLEVM
SFLARDLWGDMFTATDAYVKVFFGGQELRTGTVWDDNNPRWETRLDFGDVLLATGGPLRV
QVWDTDSGWDDDLLGSCDHAPKSGSHTVMCPLNHGLLKFSYQAKCLPHLTASTCLEYAPH
GLLGEPPGNRSGAVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccgtgagcttctccttggcctcctcctgctgctgctgcccacgccagcccct
gccccctgccacacagccgcgcgctccgagtgccggcgcaaacgccccttcgtgcccggc
tcgtggctggcgggagaaggcgtggacgtgaccagcctccggcgttcaggctccttcccg
gtggacacccagcatttcctgcggcctgatggcacctgcaccctctgtcgcaacgccctg
cagcaggacgccctccagcgcctgcccctggcgctcactgactggcgcgcccagggctca
ggctgccggcgccacgtggtcagggccaagggcagctccaccgaggctgttgcccgggaa
gcagctggcagcatccgcaacgactggcaggtgggtctagaggtgacccccaagcccagt
gccaacgcacgagtgaccgtggccggctctcactccaaggctgctgacttcgcggcccag
aaaacctaccaggaccagtacagcttcagcagcgactcagtggagtgtcgcttctacagt
tttcgcctggtgcacgctccccctctccaccctgatttcaagagggccctcagggccctt
ccaccccacttcaacgcctccaccgagcctgactacctcaggctcatctccaactacggc
acccacttcatccgctccatggagctgggcggccggctctcggccctcaccgcgctgcgt
acctgcatgctggccctagaagggctcacagccgacgaggtggcggactgcctggccgtg
gaggctgaggtcaacataggcggccttggcagctcctcgtcacaatacaaggcctgtgag
gagaagaagcagcagcacaagctggggacctccttccaccaggcctaccgggaacgcatt
tctgaagtagtcggcggccaccacagctccatgcacgacctgctcttcgcgaaccaggct
gagcccgagcagttctcggcctgggtggcctcgctgcaggacaggcccggcctggtggac
tacagcctggagcccctgcacatgctcctggagagccaggagccgcggcgcgaggcgctg
aggcaggccgtgagcaagtacctgagggacaaggcccgctggagggactgcagccggccc
tgccccccggggcagcagaagagcccccacgacccctgccagtgtgtgtgccatggctca
gcggtcaccagccacgactgctgtccccggcggaggggcatggcccggctggaggttatg
agctttctggcgagagacctgtggggagacatgttcactgccacggacgcctacgtgaaa
gtcttctttggaggccaggagctgaggaccggcacggtgtgggacgacaacaaccccagg
tgggagacgcggctggacttcggggatgtgctcctggccacgggggggccgctgagggtg
caggtctgggacacagactctggctgggacgatgacctcctcggcagctgtgaccatgct
ccgaagtctggctcacatacggtgatgtgccctctgaaccacggcctcctgaaattctcc
taccaagccaagtgcctgcctcacctgacggcgagcacctgcctggagtacgccccccac
gggctcctgggggagcctccaggaaaccggagcggggccgtgtggtga

DBGET integrated database retrieval system