KEGG   Equus caballus (horse): 100072837Help
Entry
100072837         CDS       T01058                                 

Gene name
ADI1
Definition
(RefSeq) 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00270  Cysteine and methionine metabolism
ecb01100  Metabolic pathways
Module
ecb_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    100072837 (ADI1)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     100072837 (ADI1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     100072837 (ADI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1 Cupin_3
Motif
Other DBs
NCBI-GeneID: 100072837
NCBI-ProteinID: XP_023475383
Ensembl: ENSECAG00000005765
Position
15
AA seq 179 aa AA seqDB search
MVQAWYMDEADDDPRRPHRAEPDRPVGLEQLRRLGVYYWKLDADKYENDPELEKIRKERN
YSWMDIITICKDKLPNYEEKIKIFYEEHLHLDDEVRYILEGSGYFDVRDKEDKWIRIFME
KGDLITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQSA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggcctggtacatggacgaggccgacgacgacccgcggcggccccaccgcgcg
gagcccgaccgcccggtcggcctggagcagctgcgccggctcggggtctattactggaag
ctggatgccgacaagtatgagaatgatccagaattagaaaagatccgaaaagagagaaac
tactcctggatggatatcataaccatatgcaaagataaactgccaaattatgaagaaaag
attaagatcttctacgaggagcacttgcacctggacgatgaggtccgctacatcctggag
ggcagcggctactttgatgtcagagataaagaggacaagtggatccggattttcatggag
aaaggagacctgataactctgcctgcaggcatttatcaccgcttcacgctggatgagaag
aactacgtcaaggccatgcggctgtttgtgggagaaccggtgtggacggcgtacaaccgg
ccggctgaccacttcgaggcccgaggccagtacgtgaagtttttggcgcagtcagcctag

DBGET integrated database retrieval system