KEGG   Equus caballus (horse): 100072906Help
Entry
100072906         CDS       T01058                                 

Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S-type-like
Organism
ecb  Equus caballus (horse)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipoxygenase
Motif
Other DBs
NCBI-GeneID: 100072906
NCBI-ProteinID: XP_023509154
Position
11
AA seq 131 aa AA seqDB search
MAQLTYCSLCPPDDLADRGLLGIPSALYAHDALRLWEIIARYVEGIVHLFYHRDDTVRGA
PELQAWCREITEVGLCQAQDRGKTPPQRQELLRDSAQSPFSALPFWVQDPDPSSQPPLQP
YMKHLNPIPTS
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctgacctactgctccctctgtcctcctgacgatctggctgaccgaggtctg
ctgggaatcccaagtgctctctatgcccacgatgctttgcggctctgggagatcattgcc
cggtacgtggaggggatcgtccacctcttctaccacagggatgacaccgtgagaggggcc
cctgagctgcaggcctggtgtcgggagatcactgaggtggggctctgccaggcccaggac
cgaggtaaaacccctccccagagacaggagctcctcagagactctgcccagagccccttc
tcagccctgcccttctgggttcaggaccccgacccctcatcacaaccccctctccagcca
tacatgaagcatctgaatcccattcccacctcctaa

DBGET integrated database retrieval system