KEGG   Equus caballus (horse): 100072916Help
Entry
100072916         CDS       T01058                                 

Gene name
ALOX12
Definition
arachidonate 12-lipoxygenase
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
ecb  Equus caballus (horse)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ecb00590]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:ecb04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:ecb04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 663 aa AA seqDB search
MGRYRIRVATGASLFSGSHNRVQLWLVGARGEAELELQLQPVRGQEEEFDRDVSEDLGPL
HFVKLRKHHSLVDDAWFCDRITVQGPGACAEAAFPCYRWVQGEGVLSLPEGTARLAGDNA
LDMFQKHREKELKERQQIYRWATWKEGLPLTIAAGTKDDLPPNMRFHEEKRRDFEWTMKA
GALEMVLKRVYTFLSSWDRLEDFDQIFWGQKSALAEKVHQRWQDDEFFGYQFLNGANPML
LRRSTSLPSRLVLPTGMEELRAQLEKELENSSLFEADFILLDGIPANVIRGEKQYLAAPL
IMLKMEPNGKLLPMVIQIQPPNPSSPTPPLFLPSDPPLAWLLAKSWVRNSDFQLHQLQYH
LLNTHLVAEVIAVATMRCLPGLHPVFKLLIPHIRYTMEINTRARTQLISEGGIFDKAVST
GGGGHVQLVRQAMAQLTYCSLCPPDDLADRGLLGIPSALYAHDALRLWEIIARYVEGIVH
LFYHRDDTVRGDPELQAWCREITEVGLCQAQDRGFPVSFQSQNQLCHFLTMCVFTCTAQH
AAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMTITWHLGRR
QPDMVPLGHHKEKYFSGPKAKAVLNQFQTDLENLEKEITARNEQLDLPYEYLKPSHIENS
VTI
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggccggtaccgcatccgcgtggccaccggggcctcgctcttctccgggtcgcacaac
cgcgtgcagctgtggctggtcggggcgcgcggggaggcggagctggagctgcagctgcag
ccggtgcggggccaggaggaagagtttgatcgagacgtttccgaggacttggggccactg
cacttcgtgaagctgcgcaaacaccactccctggtggacgacgcgtggttctgcgaccgc
atcacggtgcagggccctggagcctgcgcggaggccgccttcccgtgttaccgctgggtg
cagggcgagggcgtgctgagcctgcccgagggcaccgcccgcctggcaggagacaatgca
ttggacatgttccagaaacatcgagagaaggaactgaaggaaagacaacagatataccgc
tgggccacctggaaggaagggttgcccctgacaatagctgcggggactaaggatgaccta
cctccaaatatgagattccacgaggagaagagacgggactttgaatggacaatgaaggca
ggggctctggagatggtcctcaaacgcgtttataccttcctgagctcctgggaccgccta
gaagattttgatcagatcttctggggccagaagagcgccctggctgagaaggttcaccag
cgctggcaggatgatgagttttttggttaccagttcctcaacggtgccaatcccatgctg
ttgagacgctccacctctctgccctcccggctagtgctgcccacggggatggaggagctt
cgggcccagttggagaaagaacttgagaacagttccctgtttgaggccgacttcatcctt
ctggatgggattccagccaatgtgatccgaggagagaagcagtacctggctgcacccctt
atcatgctaaagatggaacccaatgggaagctgctacccatggtcatccagatccagcca
cccaaccccagctccccaaccccaccactgttcctgccctcagatcctccacttgcctgg
ctcctggcaaagtcctgggtccgaaattcagatttccaactgcaccagctccaatatcat
ttgctgaacactcatctggtggctgaggtcatcgctgtcgccaccatgaggtgcctccca
gggctacaccctgtcttcaagctcctgatcccacacatccgctacaccatggaaattaac
acccgggcaaggacccagctcatctcagaaggtggtatatttgataaggcagtgagcaca
ggtggagggggccatgtgcagctggtccgtcaggccatggcccagctgacctactgctcc
ctctgtcctcctgacgatctggctgaccgaggtctgctgggaatcccaagtgctctctat
gcccacgatgctttgcggctctgggagatcattgcccggtacgtggaggggatcgtccac
ctcttctaccacagggatgacaccgtgagaggggaccctgagctgcaggcctggtgtcgg
gagatcactgaggtggggctctgccaggcccaggaccgaggtttccctgtctccttccag
tcccagaatcaactctgccatttccttactatgtgtgtcttcacgtgcactgcccagcac
gcggccatcaaccagggccagctggactggtatgcctgggtccctaacgccccatgcaca
atgcggatgcccccacccaccaccaaggaagatgtgacaatggccacagtgatgggctca
ctacctgacgtccgacaggcctgtcttcagatgaccatcacctggcatctgggtcgccga
cagccagacatggtgcctctggggcatcacaaagaaaagtatttctcaggtcccaaggcc
aaggctgtactaaaccaattccaaacagatctggaaaacttggaaaaggagattacagcc
cggaatgagcaacttgacctgccctatgaatatctgaagcccagccacatagagaacagt
gtcactatctga

DBGET integrated database retrieval system