KEGG   Equus caballus (horse): 100072916Help
Entry
100072916         CDS       T01058                                 

Gene name
ALOX12
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S-type
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
ecb  Equus caballus (horse)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100072916 (ALOX12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100072916 (ALOX12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100072916 (ALOX12)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     100072916 (ALOX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 656 aa AA seqDB search
WATGASLFSGSHNRVQLWLVGARGEAELELQLQPARGQEEEFDRDVSEDLGPLHFVKLRK
HHSLVDDAWFCDRITVQGPGACAEAAFPCYRWVQGEGVLSLPEGTARLAGDNALDMFQKH
REKELKERQQIYRWATWKEGLPLTIAAGTKDDLPPNMRFHEEKRRDFEWTMKAGALEMVL
KRVYTFLSSWDRLEDFDQIFWGQKSALAEKVHQRWQDDEFFGYQFLNGANPMLLRRSTSL
PSRLVLPTGMEELRAQLEKELENSSLFEADFILLDGIPANVIRGEKQYLAAPLIMLKMEP
NGKLLPMVIQIQPPNPSSPTPPLFLPSDPPLAWLLAKSWVRNSDFQLHQLQYHLLNTHLV
AEVIAVATMRCLPGLHPVFKLLIPHIRYTMEINTRARTQLISEGGIFDKAVSTGGGGHVQ
LVRQAMAQLTYCSLCPPDDLADRGLLGIPSALYAHDALRLWEIIARYVEGIVHLFYHRDD
TVRGDPELQAWCREITEVGLCQAQDRGFPVSFQSQNQLCHFLTMCVFTCTAQHAAINQGQ
LDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMTITWHLGRRQPDMVPL
GHHKEKYFSGPKAKAVLNQFQTDLENLEKEITARNEQLDLPYEYLKPSHIENSVTI
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
tgggccaccggggcctcgctcttctccgggtcgcacaaccgcgtgcagctgtggctggtc
ggggcgcgcggggaggcggagctggagctgcagctgcagccggcgcggggccaggaggaa
gagtttgatcgagacgtttccgaggacttggggccactgcacttcgtgaagctgcgcaaa
caccactccctggtggacgacgcgtggttctgcgaccgcatcacggtgcagggccctgga
gcctgcgcggaggccgccttcccgtgttaccgctgggtgcagggcgagggcgtgctgagc
ctgcccgagggcaccgcccgcctggcaggagacaatgcattggacatgttccagaaacat
cgagagaaggaactgaaggaaagacaacagatataccgctgggccacctggaaggaaggg
ttgcccctgacaatagctgcggggactaaggatgacctacctccaaatatgagattccac
gaggagaagagacgggactttgaatggacaatgaaggcaggggctctggagatggtcctc
aaacgcgtttataccttcctgagctcctgggaccgcctagaagattttgatcagatcttc
tggggccagaagagcgccctggctgagaaggttcaccagcgctggcaggatgatgagttt
tttggttaccagttcctcaacggtgccaatcccatgctgttgagacgctccacctctctg
ccctcccggctagtgctgcccacggggatggaggagcttcgggcccagttggagaaagaa
cttgagaacagttccctgtttgaggccgacttcatccttctggatgggattccagccaat
gtgatccgaggagagaagcagtacctggctgcaccccttatcatgctaaagatggaaccc
aatgggaagctgctacccatggtcatccagatccagccacccaaccccagctccccaacc
ccaccactgttcctgccctcagatcctccacttgcctggctcctggcaaagtcctgggtc
cgaaattcagatttccaactgcaccagctccaatatcatttgctgaacactcatctggtg
gctgaggtcatcgctgtcgccaccatgaggtgcctcccagggctacaccctgtcttcaag
ctcctgatcccacacatccgctacaccatggaaattaacacccgggcaaggacccagctc
atctcagaaggtggtatatttgataaggcagtgagcacaggtggagggggccatgtgcag
ctggtccgtcaggccatggcccagctgacctactgctccctctgtcctcctgacgatctg
gctgaccgaggtctgctgggaatcccaagtgctctctatgcccacgatgctttgcggctc
tgggagatcattgcccggtacgtggaggggatcgtccacctcttctaccacagggatgac
accgtgagaggggaccctgagctgcaggcctggtgtcgggagatcactgaggtggggctc
tgccaggcccaggaccgaggtttccctgtctccttccagtcccagaatcaactctgccat
ttccttactatgtgtgtcttcacgtgcactgcccagcacgcggccatcaaccagggccag
ctggactggtatgcctgggtccctaacgccccatgcacaatgcggatgcccccacccacc
accaaggaagatgtgacaatggccacagtgatgggctcactacctgacgtccgacaggcc
tgtcttcagatgaccatcacctggcatctgggtcgccgacagccagacatggtgcctctg
gggcatcacaaagaaaagtatttctcaggtcccaaggccaaggctgtactaaaccaattc
caaacagatctggaaaacttggaaaaggagattacagcccggaatgagcaacttgacctg
ccctatgaatatctgaagcccagccacatagagaacagtgtcactatctga

DBGET integrated database retrieval system