KEGG   Equus caballus (horse): 100073074Help
Entry
100073074         CDS       T01058                                 

Gene name
USP43
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 43 isoform X1
  KO
K11856  ubiquitin carboxyl-terminal hydrolase 43 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100073074 (USP43)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100073074 (USP43)
Ubiquitin system [BR:ecb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100073074 (USP43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 100073074
NCBI-ProteinID: XP_023509267
Position
11
AA seq 1137 aa AA seqDB search
MDPGPGAAAGEGLPAPRPRRRRSLRRLFSRFLLALGSRSRPGDSPPRPQPQPQPGHCDGD
GEGGFTCAPGPAPAAPGSPGEERPPRSQTQLPAGDGARPPGAQGLKNHGNTCFMNAVVQC
LSNTDLLAEFLALGRYRAAPGRAEVTEQLAALVRALWTREYTPQLSAEFKNAVSKYGSQF
QGNSQHDALEFLLWLLDRVHEDLEGSSRGPGSEKLQPEASKTSENLLSPPAQLSLGQSFV
QSHFQAQYRSSLTCPHCRKQSNTFDPFLCVSLPIPLRQTRFLSVTLVFLSKSQRFLRVGL
AVPILSTVAALRKMVAEEGGVPVDEVILVELHPSGLQRSFFDEEDLNTIAEGDSIYAFQA
PPPTSRELLLARPPGLSVSPHLAAREGQRASLPAHGENKVLLLFCNVVGSGLQASRFGPP
FLMREDRTISWVQLQQCILSKVRYLMKSEAPIQNPGSMFSIRVVGLSLACSYLSAQDGRP
LCHWAVDRALHLRRPGGPPHVKLAVEWDSGAKERLFGSLQEERVQDADSVWQQQQAHQQH
SCTLDECFQFYTKEEQLAQDDAWRCPHCKALQQGMVKLSLWTLPDILIIHLKRFCQVGER
RNKLSTLVEFPLSGLDMAPHVAQRSTSPKPEPGPWPSWRQPACLPTSYPLDFLYDLYAVC
NHHGSLQGGHYTAYCRNSLDGQWYSYDDSTVEPLPEDEVNTRGAYILFYQKRNSIPPWSA
SSSMRGSTSSSLSDHWLLRLGSNNSTRGSLVSWSSAPGPSQPQVPDPPVFTNSLSSQENG
GLESRPLVRGVRGRSISMKVPTPSRAKQGAFKTMPLRWSFGPREKPLGASVELVEYLESR
RRPRSTSQSIVQLLTGAAGGDEKSAAPKSNTTLSAKGEDSGPASETVLAGVSCPSGHPSH
CVVPGNSDGLNTARKLKENASQDIRLPKKFNLPLAVMPSMENEKRARPEGQRTANWKGGG
QAGSSGRAPSPKEVPRTMALSRNSADSHRGTFAKIRANGEGRDSETDRVPQGTLTLLRSV
FWKKENKNHDRAEVAPQASSVSLVSGRLSRAVDEPVQGWSPPLRIPGGPASRLERDVRSA
PSSLHLPRKAGRPPRGSTLGMSQRSAPGEQTSFGTLQKVKYHTLSLGRKKTLPESSL
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atggacccgggcccgggggccgcggcaggagaggggcttcccgcgccccggccccgccgc
cgccgctccctgcgccgcctgttcagccgcttcctgctggcgctgggcagccgctcccgc
cccggggactcgccgccccggccccagccccagccccagccgggacactgcgatggcgac
ggtgagggcgggtttacctgcgcccccggccccgctccagccgcccccgggagccccggg
gaggagcgcccacccagatcccagacccagctccccgctggcgatggggcgcggcccccg
ggagcgcagggcttgaagaaccacggcaacacctgtttcatgaacgccgtggtgcagtgt
ctcagcaacaccgacctgctggccgagttcctggcgctggggcggtaccgggcggcaccg
ggccgcgccgaggtcaccgagcagctggcggcgctggtgcgcgcgctctggacacgcgaa
tacacaccccaactttccgccgagttcaagaatgctgtttccaagtacggctcgcaattc
caaggcaattcccagcatgacgccctggagttcctgctctggttgctggatcgggtgcac
gaggacttggagggctcgtcccgagggccggggtccgagaagcttcagcctgaagccagt
aaaacctctgagaacctcctgtcaccgccggctcagctttctctaggtcaaagctttgtg
cagagccactttcaagcacaatatagatcttccttgacctgtccccactgccggaagcag
agcaacaccttcgatcctttcctgtgtgtgtcactgcctatccccttgcgccagacgaga
ttcttgagcgtcaccttggtcttcctctcaaagagccagcggttcctgcgggtaggcctg
gccgtgccgattctcagcacagtggcagccctgaggaagatggtggcagaggaaggcggc
gtccctgtggatgaggtgatcttggttgagctgcatcccagtggactccagcggtctttc
tttgatgaagaggatctgaatactattgccgagggagacagcatatatgccttccaggcc
cctccacccaccagccgggagctacttctggctcgtccgcccggtctgtcggtctccccg
cacttggcggcccgcgaggggcagcgggcatcgctgcctgcccatggggagaacaaggtg
ctgctcctcttctgtaacgtggtggggtcggggctgcaggccagcaggtttgggccacct
ttcctgatgagggaagacagaaccatttcctgggtccagctccagcagtgcattctcagt
aaggtccgctatcttatgaagagtgaggcccccatacagaacccagggtcgatgttctcc
atccgggtggtggggctctccctggcctgcagctacttatccgcacaggacggccggccc
ctctgtcactgggcagttgatagggctttgcacctccggaggcctggagggcccccccac
gtcaaactggctgtggagtgggacagcggagccaaggaacgcctgttcgggagcctccag
gaggagcgggtccaggatgcggacagcgtgtggcagcagcagcaggcgcaccagcagcac
agctgcaccttggatgagtgcttccagttctacaccaaggaggagcagctggcccaggat
gacgcgtggcggtgtccccactgcaaagccctccagcagggcatggtgaagctgagtctg
tggaccctgcctgacatcctcatcatccacctcaaaaggttctgtcaagtgggcgagaga
agaaacaagctctccacgctggtggagttcccgctctccgggcttgacatggctccccat
gtggctcagagaagcaccagccccaagcctgagccaggcccctggccctcctggaggcag
ccggcctgcctgcccaccagctacccgctggacttcctgtacgacttgtacgccgtctgc
aaccaccacggcagtctgcaaggtgggcattacacagcctactgccggaactctctggac
gggcagtggtacagttacgatgacagcacggtggaaccacttccagaagatgaggtcaat
acccgaggggcctacatcctgttttatcagaaacggaacagcatccctccctggtcagcc
agcagctccatgcgaggttccaccagctcctccttatctgatcactggctccttcggctt
gggagcaataacagcacgaggggaagcctggtgtcctggagctctgcgcccggcccctcc
cagccccaggtgcctgaccctcccgtcttcacaaacagcctctccagtcaggaaaacgga
gggttggagtccaggcctttggtacggggcgtacgaggccgaagcattagcatgaaggtg
cccaccccttccagagccaagcagggggccttcaagaccatgcccctccggtggtctttt
ggacccagggagaaaccactcggtgcatctgtcgagttggtggagtacttggagtccaga
cggagacctcgctccaccagccagtccatcgtgcagctgttgacgggagctgctggtggg
gacgagaagtcagcagcgccaaagtctaacaccaccctctctgctaagggtgaagatagt
gggccagccagtgagacagtactggccggagtgtcctgcccctcaggccaccccagccac
tgcgtggtccctggaaactcagacggtctaaacacagcaaggaaactcaaggaaaatgca
agccaggacatcaggcttcccaaaaagttcaacctaccccttgcagtgatgccctcgatg
gagaatgagaagcgagcccggccggagggccagaggaccgcgaactggaagggaggtggc
caggcagggagcagcggcagagcgccctcccccaaggaggttccgaggacaatggcattg
tctagaaacagtgcagacagtcaccggggtaccttcgccaagataagggcaaatggggaa
ggaagggactccgagacagacagagtcccccaggggaccctcacccttctgaggtctgtg
ttttggaagaaggagaacaagaatcatgacagggcagaggtggccccccaggcgtcctca
gtctccctggtgagtggcaggctgagccgggccgttgatgagccagtgcagggctggtct
ccgcccctcaggatcccagggggcccggccagccgcctcgagagagatgtccggtcagcg
cccagctctctccacctccctcgcaaggccggcaggcctccgaggggcagcacccttggc
atgtcacaaaggagcgctcccggggagcagacttctttcggcaccttgcaaaaggtgaaa
taccacactctctccttaggtcggaagaagacattgcctgagtctagcttatga

DBGET integrated database retrieval system