KEGG   Equus caballus (horse): 100073074Help
Entry
100073074         CDS       T01058                                 

Gene name
USP43
Definition
ubiquitin specific peptidase 43
Orthology
K11856  
ubiquitin carboxyl-terminal hydrolase 43 [EC:3.1.2.15]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 1230 aa AA seqDB search
MAGPGKGSACPTAQTGWKEVAPPVRTYLCLPRSQRSQKRPPPLHSSQCTPLTTPEAASGQ
SSSPFSSYSPGRPVRGAFARVPGAPRGECAGGSHGPGPGGAAGEGLPAPGPRRRRSLRRL
FSRFLLALGSRSRPGDSPPRPQPQPQPGHCDGDGEGGFTCAPGPAPAAPGSPGEERPPRS
QTQLPAGDGARPPGAQGLKNHGNTCFMNAVVQCLSNTDLLAEFLALGRYRAAPGRAEVTE
QLAALVRALWTREYTPQLSAEFKNAVSKYGSQFQGNSQHDALEFLLWLLDRVHEDLEGSS
RGPGSEKLQPEASKTSENLLSPPAQLSLGQSFVQSHFQAQYRSSLTCPHCRKQSNTFDPF
LCVSLPIPLRQTRFLSVTLVFLSKSQRFLRVGLAVPILSTVAALRKMVAEEGGVPVDEVI
LVELHPSGLQRSFFDEEDLNTIAEGDSIYAFQAPPPTSRELLLARPPGLSVSPHLAAREG
QRASLPAHGENKVLLLFCNVVGSGLQASRFGPPFLMREDRTISWVQLQQCILSKVRYLMK
SEAPIQNPGSMFSIRVVGLSLACSYLSAQDGRPLCHWAVDRALHLRRPGGPPHVKLAVEW
DSGAKERLFGSLQEERVQDADSVWQQQQAHQQHSCTLDECFQFYTKEEQLAQDDAWRCPH
CKALQQGMVKLSLWTLPDILIIHLKRFCQVGERRNKLSTLVEFPLSGLDMAPHVAQRSTS
PKPEPGPWPSWRQPACLPTSYPLDFLYDLYAVCNHHGSLQGGHYTAYCRNSLDGQWYSYD
DSTVEPLPEDEVNTRGAYILFYQKRNSIPPWSASSSMRGSTSSSLSDHWLLRLGSNNSTR
GSLVSWSSAPGPSQPQVPDPPVFTNSLSSQENGGLESRPLVRGVRGRSISMKVPTPSRAK
QGAFKTMPLRWSFGPREKPLGASVELVEYLESRRRPRSTSQSIVQLLTGAAGGDEKSAAP
KSNTTLSAKGEDSGPASETVLAGVSCPSGHPSHCVVPGNSDGLNTARKLKENASQDIRLP
KKFNLPLAVMPSMENEKRARPEGQRTANWKGGGQAGSSGRAPSPKEGSEDNGMSRNSADS
HRGTFAKIRANGEGRDSETDRVPQGTLTLLRSVFWKKENKNHDRAEVAPQASSVSLVSGR
LSRAVDEPVQGWSPPLRIPGGPASRLERDVRSAPSSLHLPRKAGRPPRGSTLGMSQRSAP
GEQTSFGTLQKVKYHTLSLGRKKTLPESSL
NT seq 3693 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtccaggcaaaggctctgcctgccctacggcgcaaaccggctggaaggaggtg
gcgccacctgtccgcacatacctgtgcttgccgaggagccagcgctcacaaaagcgaccc
ccaccccttcacagctcccagtgcacgcctctcactactccagaggctgccagtggacag
tcttcctctcccttttcttcatattcacctggacggcctgttagaggggcgttcgctcgg
gtcccgggggctccgcgcggggagtgcgccggcgggagccatggacccgggcccgggggc
gcggcaggagaggggcttcccgcgcccgggccccgccggcgccgctccctgcgccgcctg
ttcagccgcttcctgctggcgctgggcagccgctcccgccccggggactcgccgccccgg
ccccagccccagccccagccgggacactgcgatggcgacggtgagggcgggtttacctgc
gcccccggccccgctccagccgcccccgggagccccggggaggagcgcccacccagatcc
cagacccagctccccgctggcgatggggcgcggcccccgggagcgcagggcttgaagaac
cacggcaacacctgtttcatgaacgccgtggtgcagtgtctcagcaacaccgacctgctg
gccgagttcctggcgctggggcggtaccgggcggcaccgggccgcgccgaggtcaccgag
cagctggcggcgctggtgcgcgcgctctggacacgcgaatacacaccccaactttccgcc
gagttcaagaatgctgtttccaagtacggctcgcaattccaaggcaattcccagcatgac
gccctggagttcctgctctggttgctggatcgggtgcacgaggacttggagggctcgtcc
cgagggccggggtccgagaagcttcagcctgaagccagtaaaacctctgagaacctcctg
tcaccgccggctcagctttctctaggtcaaagctttgtgcagagccactttcaagcacaa
tatagatcttccttgacctgtccccactgccggaagcagagcaacaccttcgatcctttc
ctgtgtgtgtcactgcctatccccttgcgccagacgagattcttgagcgtcaccttggtc
ttcctctcaaagagccagcggttcctgcgggtaggcctggccgtgccgattctcagcaca
gtggcagccctgaggaagatggtggcagaggaaggcggcgtccctgtggatgaggtgatc
ttggttgagctgcatcccagtggactccagcggtctttctttgatgaagaggatctgaat
actattgccgagggagacagcatatatgccttccaggcccctccacccaccagccgggag
ctacttctggctcgtccgcccggtctgtcggtctccccgcacttggcggcccgcgagggg
cagcgggcatcgctgcctgcccatggggagaacaaggtgctgctcctcttctgtaacgtg
gtggggtcggggctgcaggccagcaggtttgggccacctttcctgatgagggaagacaga
accatttcctgggtccagctccagcagtgcattctcagtaaggtccgctatcttatgaag
agtgaggcccccatacagaacccagggtcgatgttctccatccgggtggtggggctctcc
ctggcctgcagctacttatccgcacaggacggccggcccctctgtcactgggcagttgat
agggctttgcacctccggaggcctggagggcccccccacgtcaaactggctgtggagtgg
gacagcggagccaaggaacgcctgttcgggagcctccaggaggagcgggtccaggatgcg
gacagcgtgtggcagcagcagcaggcgcaccagcagcacagctgcaccttggatgagtgc
ttccagttctacaccaaggaggagcagctggcccaggatgacgcgtggcggtgtccccac
tgcaaagccctccagcagggcatggtgaagctgagtctgtggaccctgcctgacatcctc
atcatccacctcaaaaggttctgtcaagtgggcgagagaagaaacaagctctccacgctg
gtggagttcccgctctccgggcttgacatggctccccatgtggctcagagaagcaccagc
cccaagcctgagccaggcccctggccctcctggaggcagccggcctgcctgcccaccagc
tacccgctggacttcctgtacgacttgtacgccgtctgcaaccaccacggcagtctgcaa
ggtgggcattacacagcctactgccggaactctctggacgggcagtggtacagttacgat
gacagcacggtggaaccacttccagaagatgaggtcaatacccgaggggcctacatcctg
ttttatcagaaacggaacagcatccctccctggtcagccagcagctccatgcgaggttcc
accagctcctccttatctgatcactggctccttcggcttgggagcaataacagcacgagg
ggaagcctggtgtcctggagctctgcgcccggcccctcccagccccaggtgcctgaccct
cccgtcttcacaaacagcctctccagtcaggaaaacggagggttggagtccaggcctttg
gtacggggcgtacgaggccgaagcattagcatgaaggtgcccaccccttccagagccaag
cagggggccttcaagaccatgcccctccggtggtcttttggacccagggagaaaccactc
ggtgcatctgtcgagttggtggagtacttggagtccagacggagacctcgctccaccagc
cagtccatcgtgcagctgttgacgggagctgctggtggggacgagaagtcagcagcgcca
aagtctaacaccaccctctctgctaagggtgaagatagtgggccagccagtgagacagta
ctggccggagtgtcctgcccctcaggccaccccagccactgcgtggtccctggaaactca
gacggtctaaacacagcaaggaaactcaaggaaaatgcaagccaggacatcaggcttccc
aaaaagttcaacctaccccttgcagtgatgccctcgatggagaatgagaagcgagcccgg
ccggagggccagaggaccgcgaactggaagggaggtggccaggcagggagcagcggcaga
gcgccctcccccaaggagggttccgaggacaatggcatgtctagaaacagtgcagacagt
caccggggtaccttcgccaagataagggcaaatggggaaggaagggactccgagacagac
agagtcccccaggggaccctcacccttctgaggtctgtgttttggaagaaggagaacaag
aatcatgacagggcagaggtggccccccaggcgtcctcagtctccctggtgagtggcagg
ctgagccgggccgttgatgagccagtgcagggctggtctccgcccctcaggatcccaggg
ggcccggccagccgcctcgagagagatgtccggtcagcgcccagctctctccacctccct
cgcaaggccggcaggcctccgaggggcagcacccttggcatgtcacaaaggagcgctccc
ggggagcagacttctttcggcaccttgcaaaaggtgaaataccacactctctccttaggt
cggaagaagacattgcctgagtctagcttatga

DBGET integrated database retrieval system