KEGG   Equus caballus (horse): 100073086Help
Entry
100073086         CDS       T01058                                 

Gene name
ARG1
Definition
(RefSeq) arginase-1 isoform X1
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00220  Arginine biosynthesis
ecb00330  Arginine and proline metabolism
ecb01100  Metabolic pathways
ecb01230  Biosynthesis of amino acids
ecb05146  Amoebiasis
Module
ecb_M00029  Urea cycle
ecb_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    100073086 (ARG1)
   00330 Arginine and proline metabolism
    100073086 (ARG1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100073086 (ARG1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100073086 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 100073086
NCBI-ProteinID: XP_001503335
Ensembl: ENSECAG00000023485
Position
10
AA seq 348 aa AA seqDB search
MCSPSLRVAEWQLAGDLGCSDKKCQSMSSKSKSIGVIGAPFSKGQPRGGVEEGPTVLRKA
GLLEKLKELECDVKDYGDLPFADVPNDSPFGIVKNPRSVGRASEQLAGVVAEVKKSGRTS
LVLGGDHSLAIGSISGHARVHPDLCVIWVDAHSDINTPLTTTSGNLHGQPVSFLLQELKG
QIPDVPGFSWMTPCLSAKDIVYIGLRDVDPGEHYILKTLGMKYFSMTEVDKLGIGKVMEE
ALSYLVGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLSYREGVYITEEIYKTGLLSGLD
IMEVNPSLGKTPEEVTSTVNTAVAVTLACFGAAREGNHKTIDYLSPLK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtgctctccgtcattgagggttgcagagtggcagctggctggagacctcgggtgcagt
gacaagaagtgtcagagcatgagttccaagtcaaaatccataggggtcatcggagctcct
ttctcaaagggccagccacgaggaggagtggaagaaggccctacagtattgagaaaggct
ggtctgcttgagaaacttaaggaactagagtgtgatgtgaaagactacggggacctgcct
ttcgccgatgtccctaacgacagtccctttggaattgtgaagaatccaaggtccgtggga
agagcgagtgagcagctggccggtgtggtggcggaagtcaagaagagtggccggaccagc
ctggtgctgggtggagaccacagcttggccattggcagcatctccggccacgccagggtc
cacccggatctctgtgtcatttgggtggatgctcacagcgatatcaacactccactgaca
accacaagtgggaacttgcacggacagcctgtgtctttcctcctgcaggaactaaaggga
cagatccccgatgtgccaggattctcctggatgactccctgcctatctgccaaagacatc
gtgtacatcggcctgagagacgtggaccctggggaacactacattttgaaaactctgggt
atgaaatacttttcaatgactgaagtggataaactggggattggcaaggtgatggaagaa
gcactcagctatctagtaggaagaaagaaaaggccaattcatttgagctttgacgttgat
ggactggacccgtctttcacgccagctactggcacaccagtcgtgggaggtctgtcttac
agagaaggtgtctacatcacagaagaaatttacaaaacagggctactctcaggattagat
ataatggaagtaaacccatctctggggaagacaccagaagaagtcacttccacggtgaac
acagcggtggcagtaaccttggcttgttttggagctgctcgggagggtaatcataagact
attgactaccttagcccgctgaagtaa

DBGET integrated database retrieval system