KEGG   Equus caballus (horse): 100073094Help
Entry
100073094         CDS       T01058                                 

Gene name
MAP2K4
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4 isoform X1
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04620  Toll-like receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04668  TNF signaling pathway
ecb04912  GnRH signaling pathway
ecb04926  Relaxin signaling pathway
ecb05142  Chagas disease (American trypanosomiasis)
ecb05161  Hepatitis B
ecb05164  Influenza A
ecb05166  HTLV-I infection
ecb05167  Kaposi's sarcoma-associated herpesvirus infection
ecb05169  Epstein-Barr virus infection
ecb05418  Fluid shear stress and atherosclerosis
Module
ecb_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100073094 (MAP2K4)
   04012 ErbB signaling pathway
    100073094 (MAP2K4)
   04668 TNF signaling pathway
    100073094 (MAP2K4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100073094 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    100073094 (MAP2K4)
  Endocrine system
   04912 GnRH signaling pathway
    100073094 (MAP2K4)
   04926 Relaxin signaling pathway
    100073094 (MAP2K4)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100073094 (MAP2K4)
  Infectious diseases
   05166 HTLV-I infection
    100073094 (MAP2K4)
   05164 Influenza A
    100073094 (MAP2K4)
   05161 Hepatitis B
    100073094 (MAP2K4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100073094 (MAP2K4)
   05169 Epstein-Barr virus infection
    100073094 (MAP2K4)
   05142 Chagas disease (American trypanosomiasis)
    100073094 (MAP2K4)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100073094 (MAP2K4)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: STE group
  STE7 family
   100073094 (MAP2K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 100073094
NCBI-ProteinID: XP_023509295
Ensembl: ENSECAG00000025163
Position
11
AA seq 410 aa AA seqDB search
MAAPSPSGGGGSGGGSGSGTPGPAGSPAPGHPAVSSMQGFQINFCEKAQSKRKALKLNFA
NPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIG
RGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALF
REGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRD
IKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSD
VWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLT
KDESKRPKYKELLKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggcagcggcagcggcacc
ccgggtcccgcagggtccccggcgccgggccacccggccgtcagcagcatgcagggcttt
cagataaacttctgtgaaaaggcacaaagtaaacgcaaagcactgaagttgaattttgca
aatccacctttcaaatctacagcaaggtttactctgaatcccaatcctacaggagttcaa
aacccacacatagagagactgagaacacacagcattgaatcgtcaggaaaactgaagatc
tcccctgaacaacactgggatttcactgcagaggacttgaaagaccttggagaaattgga
cgaggagcttatggttccgtcaacaaaatggtccacaaaccaagtgggcaaataatggca
gttaaaagaattcggtcaacagtggatgaaaaagaacaaaaacaacttctcatggatttg
gatgtagtaatgcggagtagtgattgcccatacattgttcaattttatggtgcactcttc
agagagggtgactgttggatctgtatggaactcatgtctacctcgtttgataagttttac
aaatatgtatatagtgtattagatgatgttattccagaagaaattttaggcaaaatcact
ttagcaactgtgaaggctctaaaccacttaaaggaaaacttgaaaatcattcacagagat
atcaaaccttccaatattcttctggacagaagtggaaatattaaactctgtgactttggc
atcagtggacagcttgtggactccattgccaagacaagagatgctgggtgtagaccatac
atggcacctgaaagaatagacccaagtgcgtcgcgacaaggatatgatgtccgctctgac
gtctggagtttggggatcacattgtacgagttggccacgggccgatttccttatccaaag
tggaatagtgtatttgatcaactaacacaagtcgtaaaaggagatcctccacagctgagc
aattctgaggaaagagaattctccccaagtttcatcaactttgtcaacttgtgccttaca
aaggatgaatccaaaaggccaaagtataaagaacttctgaaacatccctttattttgatg
tatgaagaacgtaccgtagaggtcgcatgctatgtttgtaaaatcctggatcaaatgcca
gctactcccagctctcccatgtatgtcgattga

DBGET integrated database retrieval system