KEGG   Equus caballus (horse): 100073094Help
Entry
100073094         CDS       T01058                                 

Gene name
MAP2K4
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
ecb  Equus caballus (horse)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
GnRH signaling pathway
Relaxin signaling pathway
Chagas disease (American trypanosomiasis)
Hepatitis B
Influenza A
HTLV-I infection
Kaposi's sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Fluid shear stress and atherosclerosis
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100073094 (MAP2K4)
   04012 ErbB signaling pathway
    100073094 (MAP2K4)
   04668 TNF signaling pathway
    100073094 (MAP2K4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100073094 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    100073094 (MAP2K4)
  Endocrine system
   04912 GnRH signaling pathway
    100073094 (MAP2K4)
   04926 Relaxin signaling pathway
    100073094 (MAP2K4)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100073094 (MAP2K4)
  Infectious diseases
   05166 HTLV-I infection
    100073094 (MAP2K4)
   05164 Influenza A
    100073094 (MAP2K4)
   05161 Hepatitis B
    100073094 (MAP2K4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100073094 (MAP2K4)
   05169 Epstein-Barr virus infection
    100073094 (MAP2K4)
   05142 Chagas disease (American trypanosomiasis)
    100073094 (MAP2K4)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100073094 (MAP2K4)
Protein kinases [BR:ecb01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100073094 (MAP2K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
11
AA seq 411 aa AA seqDB search
MGQQVTQLKMGLLKEDSSYILHSLIPEEHRIIPHHREKTIEVDATAASASCKRKALKLNF
ANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEI
GRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGAL
FREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHR
DIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRS
DVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCL
TKDESKRPKYKELLKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgggccagcaggtaacacaactcaagatgggccttttgaaagaagatagcagttacatc
ctacacagcttgattcctgaagaacaccgcatcattccccaccacagggaaaagacgatc
gaagtggatgccacggcagcttctgcaagctgtaaacgcaaagcactgaagttgaatttt
gcaaatccacctttcaaatctacagcaaggtttactctgaatcccaatcctacaggagtt
caaaacccacacatagagagactgagaacacacagcattgaatcgtcaggaaaactgaag
atctcccctgaacaacactgggatttcactgcagaggacttgaaagaccttggagaaatt
ggacgaggagcttatggttccgtcaacaaaatggtccacaaaccaagtgggcaaataatg
gcagttaaaagaattcggtcaacagtggatgaaaaagaacaaaaacaacttctcatggat
ttggatgtagtaatgcggagtagtgattgcccatacattgttcaattttatggtgcactc
ttcagagagggtgactgttggatctgtatggaactcatgtctacctcgtttgataagttt
tacaaatatgtatatagtgtattagatgatgttattccagaagaaattttaggcaaaatc
actttagcaactgtgaaggctctaaaccacttaaaggaaaacttgaaaatcattcacaga
gatatcaaaccttccaatattcttctggacagaagtggaaatattaaactctgtgacttt
ggcatcagtggacagcttgtggactccattgccaagacaagagatgctgggtgtagacca
tacatggcacctgaaagaatagacccaagtgcgtcgcgacaaggatatgatgtccgctct
gacgtctggagtttggggatcacattgtacgagttggccacgggccgatttccttatcca
aagtggaatagtgtatttgatcaactaacacaagtcgtaaaaggagatcctccacagctg
agcaattctgaggaaagagaattctccccaagtttcatcaactttgtcaacttgtgcctt
acaaaggatgaatccaaaaggccaaagtataaagaacttctgaaacatccctttattttg
atgtatgaagaacgtaccgtagaggtcgcatgctatgtttgtaaaatcctggatcaaatg
ccagctactcccagctctcccatgtatgtcgattga

DBGET integrated database retrieval system