KEGG   Equus caballus (horse): 100073254Help
Entry
100073254         CDS       T01058                                 

Gene name
RASGRF2
Definition
(RefSeq) ras-specific guanine nucleotide-releasing factor 2 isoform X1
  KO
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
ecb  Equus caballus (horse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100073254 (RASGRF2)
   04010 MAPK signaling pathway
    100073254 (RASGRF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
14
AA seq 1264 aa AA seqDB search
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERAPAPPRAGAGPGSAREALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKVAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEEPDAGDDDS
KGSGQMFGHLDFKIVVEPPDAAPFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLAKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIGALDLTTSSASSSPTTTQSPAASPP
PHTGKVPLDLSRGLSSPEQSPGSVEEHVDNPRVDLCNKLKRSIQRAAVLESAPGDRAGVE
GSPAVDAAELSPSRSPSTPRHLRYRQPGGQTTDNSHCSVSPASAFAIATAAAGHGSPPVL
DTLGFSIVRRILRSNAKSMEQRGFNNTERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDF
ELNNELKMNVLNLLEEVLRDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQLTDCP
KAECFETLSAMELAEQITLLDHIVFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDM
SNLVASQIMNYADISSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWA
KVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTE
EGLVNFSKMRMISHIIREIRQFQQTSYRIDHQPKVTQYLLDKALIIDEDTLYELSLKIEP
RLPA
NT seq 3795 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgtacctggccttcctggcccgc
aaggagggcaccaagcgcggcttcctgagcaagaaggcagcggaggcgagccgctggcac
gagaagtggttcgcgctctaccagaatgtgctcttctacttcgagggcgagcagagcggc
cgcccggcgggcatgtacctcctggagggctgcagctgcgagcgcgcgcccgcgccgccc
agggccggggccgggccgggcagcgcccgggaagcgctggacaagcagtattactttact
gttctttttggccacgaaggtcagaaaccactggagctgcgctgtgaggaggagcaggac
ggtaaagagtggatggaggccattcaccaagccagttatgcagacatattgattgagagg
gaagtgttaatgcagaagtacattcatctagttcagatcgtagagacagaaaaagttgca
gctaaccaactccggcaccaacttgaagatcaagatacagaaatcgaaaggcttaaatca
gagattatcgctcttaataaaaccaaggaacggatgagaccttaccaaagcaatcaagaa
gatgaggatccagacatcaagaagattaaaaaggttcagagcttcatgcgaggatggttg
tgtagaaggaagtggaagaccatcgtgcaggattacatttgttctcctcatgctgaaagt
atgaggaagagaaaccagattgtattcaccatggttgaggccgagtcagagtacgtccac
cagctgtacatcctggtaaatggcttcctccggcccctgcggatggcggccagctccaag
aagccccccatcagccacgacgacgtcagcagtatttttctcaacagtgaaacaatcatg
tttcttcatgaaatatttcatcaaggactgaaagcaaggatagcaaactggcctacttta
attttagctgatctgtttgatattttgctccccatgctgaacatttatcaagaatttgtg
cgcaatcaccagtacagcctccaagtgcttgccaattgtaagcaaaatagagattttgac
aaactcttaaaacagtatgaagccaaccctgcctgtgaggggaggatgctggaaacgttc
ttgacctatccaatgtttcagatccccaggtatatcatcacacttcatgaactcctcgct
catacgccccatgagcatgtggagaggaaaagtctggaatttgctaaatcaaaattagaa
gaactgtccagggtaatgcacgatgaagtaagcgacactgaaaacataaggaagaacctt
gccatagaaagaatgatcgttgagggctgtgatattttgctggacaccagccaaactttc
atccgccaaggttctcttattcaagtaccttccgttgagagggggaaacttagtaaagtt
cgcctgggttcattgtctttgaaaaaggaaggagaaagacaatgcttcttatttacaaaa
cactttttaatttgtacaagaagttcaggaggaaagctgcatctgctcaagacaggtggg
gttctgtctctaatagaatgtacgttgattgaggagcccgatgccggtgacgatgattcc
aaaggttctgggcaaatgtttggacacctggattttaaaatcgtggtggagccccctgat
gctgcccccttcacggtggtcttgttagcaccttcacgccaggagaaagctgcctggatg
agcgacataagtcagtgtgtggacaatatacggtgtaatggtttaatgactatagtgttt
gaagagaattccaaagttactgtgccacatatgattaagtctgatgcccgtcttcataag
gatgacactgacatttgcttcagtaaaacactcaactcctgcaaagtgccccagatccgt
tatgccagcgtggagcgcctcttggagcggctgacagacttacggtttcttagtatcgat
ttcctcaacaccttcctgcacacctatcggattttcaccacagcagctgtggtgctggcg
aagctttctgacatctacaagaggccttttacctccatccccgtcaggtcattggaattg
ttttttgctaccagccagaacaacagaggcgaacatttggtggatggcaaatccccacgc
ctgtgtcgcaaattctcttccccaccaccactggctgtgtccagaacgtcctcccccgtg
agggccagaaagctgtccttgacttctcccttgaactcaaggataggcgcattggacctg
accacctcctctgcgtccagcagtcctaccaccacccaaagccctgctgcgtcccctcca
ccacacactggtaaagtaccattggatcttagcagaggcctttcttctccagaacaaagc
ccaggatctgtagaagagcatgtagataacccccgcgtggacctgtgtaacaagctaaag
cggagtattcaaagagcagcagtcctagagtctgcaccaggggaccgagcaggagtggaa
ggctccccagcagtggacgccgcagagctttcacctagcaggtcaccctcgactcctcga
cacctccgctatcgccagcctggaggacagacgactgacaactcccactgctctgtttcg
cctgcttctgcttttgcaatcgccacggctgcagcaggacacgggagtccaccggtactg
gacacactgggtttttccatagtcagaaggatcttgagaagtaacgctaaatctatggaa
caaagaggatttaacaacaccgagagaacatgcgacaaagagtttattatacgtagaaca
gccaccaatcgagtactgaatgtcctccgtcactgggtctcaaagcacgcacaggatttt
gaactcaacaatgaactaaagatgaacgtcttaaatttgctagaagaagttttgcgagat
ccagaccttcttccgcaagaaaggaaagccacggcaaatatcctgagggccctttcacaa
gatgatcaagatgacatccacctaaaattagaggacataattcaactgacggactgtccg
aaggccgagtgctttgagaccttgtcagccatggagctggcggagcagatcaccctcctg
gaccacatcgtcttcagaagtattccctacgaagaatttcttgggcaggggtggatgaag
ctggataaaaatgaaagaacaccttacattatgaaaaccagccaacacttcaatgatatg
agtaacctggtggcctcccagataatgaattatgccgacatcagctcccgggccaacgcc
attgagaagtgggtggcggtggcggacatctgccgatgcctgcacaactacaatggcgtg
ctggagatcacctcggccttaaacagaagtgccatctacaggctgaagaaaacctgggcc
aaggtgtccaagcagacgaaagctctaatggacaaacttcagaagactgtttcatctgaa
ggaagatttaaaaatctcagagaaacccttaaaaattgtaacccccctgctgttccttat
ctggggatgtacctgacagacctggcatttatcgaagaaggaacaccaaactttactgag
gaaggccttgtcaatttctccaaaatgagaatgatatcacacatcatcagagagatccgc
cagttccagcagacttcctatcgaatagaccatcagccaaaggtcactcagtacttgctt
gacaaagccctcatcatagatgaagatacgctgtatgagctgtcgctaaaaattgaacct
cggctccctgcttga

DBGET integrated database retrieval system