KEGG   Equus caballus (horse): 100073254Help
Entry
100073254         CDS       T01058                                 

Gene name
RASGRF2
Definition
Ras protein-specific guanine nucleotide-releasing factor 2
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
ecb  Equus caballus (horse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:ecb04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ecb04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 1272 aa AA seqDB search
MAGPCLLDLNVPFGVEAAGGMVQKVGNPSGLHMPIRDMLQEIDFLEGFCKFTQCGLVQLR
EKGVRMLFFKAAAPSTRETDPLDVKCPAADQMGLLVWGGIGIGDYYFTVLFGHEGQKPLE
LRCEEEQDGKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKVAANQLRHQLEDQD
TEIERLKSEIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDY
ICSPHAESMRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSI
FLNSETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLAN
CKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSL
EFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSV
ERGKLSKVRLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEE
PDAGDDDSKGSGQMFGHLDFKIVVEPPDAAPFTVVLLAPSRQEKAAWMSDISQCVDNIRC
NGLMTIVFEENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLT
DLRFLSIDFLNTFLHTYRIFTTAAVVLAKLSDIYKRPFTSIPVRSLELFFATSQNNRGEH
LVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIGALDLTTSSASSSPTTT
QSPAASPPPHTGKVPLDLSRGLSSPEQSPGSVEEHVDNPRVDLCNKLKRSIQRAAVLESA
PGDRAGVEGSPAADAAELSPSRSPSTPRHLRYRQPGGQTTDNSHCSVSPASAFAIATAAA
GHGSPPVLDTLGFSIVRRILRSNAKSMEQRGFNNTERTCDKEFIIRRTATNRVLNVLRHW
VSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQERKATANILRALSQDDQDDIHLKLED
IIQLTDCPKAECFETLSAMELAEQITLLDHIVFRSIPYEEFLGQGWMKLDKNERTPYIMK
TSQHFNDMSNLVASQIMNYADISSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAI
YRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIE
EGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTSYRIDHQPKVTQYLLDKALIIDEDTLY
ELSLKIEPRLPA
NT seq 3819 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaccctgcctcttggatctgaatgtcccatttggtgttgaggctgcaggagga
atggtccagaaggtcgggaaccccagtggccttcacatgcccatcagagacatgttgcag
gaaattgactttcttgagggtttctgcaagttcacccagtgtggtctagtgcagctgaga
gagaagggcgtccgcatgttgttcttcaaagcagcggccccatccacaagggaaaccgac
ccattggatgtgaaatgcccagcagcagatcagatggggctcctcgtttggggtggaata
ggcattggagattattactttactgttctttttggccacgaaggtcagaaaccactggag
ctgcgctgtgaggaggagcaggacggtaaagagtggatggaggccattcaccaagccagt
tatgcagacatattgattgagagggaagtgttaatgcagaagtacattcatctagttcag
atcgtagagacagaaaaagttgcagctaaccaactccggcaccaacttgaagatcaagat
acagaaatcgaaaggcttaaatcagagattatcgctcttaataaaaccaaggaacggatg
agaccttaccaaagcaatcaagaagatgaggatccagacatcaagaagattaaaaaggtt
cagagcttcatgcgaggatggttgtgtagaaggaagtggaagaccatcgtgcaggattac
atttgttctcctcatgctgaaagtatgaggaagagaaaccagattgtattcaccatggtt
gaggccgagtcagagtacgtccaccagctgtacatcctggtaaatggcttcctccggccc
ctgcggatggcggccagctccaagaagccccccatcagccacgacgacgtcagcagtatt
tttctcaacagtgaaacaatcatgtttcttcatgaaatatttcatcaaggactgaaagca
aggatagcaaactggcctactttaattttagctgatctgtttgatattttgctccccatg
ctgaacatttatcaagaatttgtgcgcaatcaccagtacagcctccaagtgcttgccaat
tgtaagcaaaatagagattttgacaaactcttaaaacagtatgaagccaaccctgcctgt
gaggggaggatgctggaaacgttcttgacctatccaatgtttcagatccccaggtatatc
atcacacttcatgaactcctcgctcatacgccccatgagcatgtggagaggaaaagtctg
gaatttgctaaatcaaaattagaagaactgtccagggtaatgcacgatgaagtaagcgac
actgaaaacataaggaagaaccttgccatagaaagaatgatcgttgagggctgtgatatt
ttgctggacaccagccaaactttcatccgccaaggttctcttattcaagtaccttccgtt
gagagggggaaacttagtaaagttcgcctgggttcattgtctttgaaaaaggaaggagaa
agacaatgcttcttatttacaaaacactttttaatttgtacaagaagttcaggaggaaag
ctgcatctgctcaagacaggtggggttctgtctctaatagaatgtacgttgattgaggag
cccgatgccggtgacgatgattccaaaggttctgggcaaatgtttggacacctggatttt
aaaatcgtggtggagccccctgatgctgcccccttcacggtggtcttgttagcaccttca
cgccaggagaaagctgcctggatgagcgacataagtcagtgtgtggacaatatacggtgt
aatggtttaatgactatagtgtttgaagagaattccaaagttactgtgccacatatgatt
aagtctgatgcccgtcttcataaggatgacactgacatttgcttcagtaaaacactcaac
tcctgcaaagtgccccagatccgttatgccagcgtggagcgcctcttggagcggctgaca
gacttacggtttcttagtatcgatttcctcaacaccttcctgcacacctatcggattttc
accacagcagctgtggtgctggcgaagctttctgacatctacaagaggccttttacctcc
atccccgtcaggtcattggaattgttttttgctaccagccagaacaacagaggcgaacat
ttggtggatggcaaatccccacgcctgtgtcgcaaattctcttccccaccaccactggct
gtgtccagaacgtcctcccccgtgagggccagaaagctgtccttgacttctcccttgaac
tcaaggataggcgcattggacctgaccacctcctctgcgtccagcagtcctaccaccacc
caaagccctgctgcgtcccctccaccacacactggtaaagtaccattggatcttagcaga
ggcctttcttctccagaacaaagcccaggatctgtagaagagcatgtagataacccccgc
gtggacctgtgtaacaagctaaagcggagtattcaaagagcagcagtcctagagtctgca
ccaggggaccgagcaggagtggaaggctccccagcagcggacgccgcagagctttcacct
agcaggtcaccctcgactcctcgacacctccgctatcgccagcctggaggacagacgact
gacaactcccactgctctgtttcgcctgcttctgcttttgcaatcgccacggctgcagca
ggacacgggagtccaccggtactggacacactgggtttttccatagtcagaaggatcttg
agaagtaacgctaaatctatggaacaaagaggatttaacaacaccgagagaacatgcgac
aaagagtttattatacgtagaacagccaccaatcgagtactgaatgtcctccgtcactgg
gtctcaaagcacgcacaggattttgaactcaacaatgaactaaagatgaacgtcttaaat
ttgctagaagaagttttgcgagatccagaccttcttccgcaagaaaggaaagccacggca
aatatcctgagggccctttcacaagatgatcaagatgacatccacctaaaattagaggac
ataattcaactgacggactgtccgaaggccgagtgctttgagaccttgtcagccatggag
ctggcggagcagatcaccctcctggaccacatcgtcttcagaagtattccctacgaagaa
tttcttgggcaggggtggatgaagctggataaaaatgaaagaacaccttacattatgaaa
accagccaacacttcaatgatatgagtaacctggtggcctcccagataatgaattatgcc
gacatcagctcccgggccaacgccattgagaagtgggtggcggtggcggacatctgccga
tgcctgcacaactacaatggcgtgctggagatcacctcggccttaaacagaagtgccatc
tacaggctgaagaaaacctgggccaaggtgtccaagcagacgaaagctctaatggacaaa
cttcagaagactgtttcatctgaaggaagatttaaaaatctcagagaaacccttaaaaat
tgtaacccccctgctgttccttatctggggatgtacctgacagacctggcatttatcgaa
gaaggaacaccaaactttactgaggaaggccttgtcaatttctccaaaatgagaatgata
tcacacatcatcagagagatccgccagttccagcagacttcctatcgaatagaccatcag
ccaaaggtcactcagtacttgcttgacaaagccctcatcatagatgaagatacgctgtat
gagctgtcgctaaaaattgaacctcggctccctgcttga

DBGET integrated database retrieval system