KEGG   Equus caballus (horse): 100073256Help
Entry
100073256         CDS       T01058                                 

Gene name
DHFR
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ecb  Equus caballus (horse)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ecb00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ecb00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 187 aa AA seqDB search
MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTASSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINLVLSRELKEPPQGAHFLAKSLDDALSLLEQPELANKVDMVWIVGGSS
VYKEAMNKPGHLRLFVTRIMQEFESDTFFPEIDFEKYKLLPEYPGVLSDIQEEKGIKYKF
EVYEKND
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtccgctaaattgcatcgtcgccgtgtcgcagaatatgggcatcggcaagaac
ggggacctgccgtggcccccactcaggaatgaattcaagtatttccaaagaatgaccaca
gcctcttcagtagaaggtaagcagaatttggtgattatgggtaggaagacctggttctcc
atccctgagaagaatcggccgttaaaggacagaattaatttagttctcagtagagaactc
aaggaacctccacaaggagctcattttcttgccaaaagtttggatgatgccttatcactt
cttgagcaaccagaattagcaaataaagtggacatggtttggatagtgggaggcagttct
gtttataaggaagccatgaacaagccaggccatcttagactgtttgtgacaaggatcatg
caggaatttgaaagtgacacattttttccagaaattgattttgaaaaatataaacttctc
ccagaatacccaggtgttctttctgatatccaggaggaaaaaggcattaagtacaaattt
gaagtatatgaaaagaatgattaa

DBGET integrated database retrieval system