KEGG   Equus caballus (horse): 100073261Help
Entry
100073261         CDS       T01058                                 

Gene name
THBS4
Definition
thrombospondin 4
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
ecb  Equus caballus (horse)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ecb04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:ecb04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:ecb04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:ecb04510]
Human Diseases; Infectious diseases; Malaria [PATH:ecb05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 951 aa AA seqDB search
MFAPKLNLSLIIPFFTFSPVFDLLPSSSQRLNPAVLKPILTDPTLNELYVIFTFKLQTRS
SATVFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKIHLVAFNNLQLADGRRHRVLLR
LTNLRRGAGSVDLYLDCKQVDSVHNLPRAFSGLSQNAESVELRTFQRKAQDFLEELKLVV
RGSLFQVASLQDCFLQQSEPLAATSTGDFNRQFLGQMTQLNQLLGEVKDLLRQQVKETTF
LRNTIAECQACGPLSFQSPTPNTLVPPAPPAPPTPPMRRCDSNPCFRGVRCTNTRDGFQC
GPCPEGYTGNGVTCSDVDECKYHPCYPGVRCVNLAPGFRCDACPVGFSGPVLQGVGISFA
KSNKQVCADIDECRNGACVLNSICVNTLGSYRCGPCKPGYTGDQTRGCKIERNCRNPELN
PCSVNAQCIEGRQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSARNCKKDNCKYV
PNSGQEDADRDGIGDACDEDADGDGVLNEQDNCVLTHNMDQRNSDKDIFGDACDNCRNVL
NNDQKDTDGDGKGDACDDDMDGDGIKNILDNCPKAPNRDQQDKDGDGVGDACDSCPDVSN
PNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDND
GIPDLVPPGPDNCRLVPNPAQEDSNRDGVGDICETDFDQDQVIDWIDVCPENAEVTLTDF
RAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQ
TDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSQTGPGEHLR
NSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGV
TIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLDN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccccaaagttaaatctttcactgattatccctttcttcacattctccccagtc
tttgaccttctgccatcctccagccagaggctgaatcctgctgtcctgaagccaatcctg
acagaccccaccctgaacgagctgtatgtgatcttcaccttcaagctgcagaccaggagc
tcagccaccgtctttggcctttactcttcgactgacaacagcaaatattttgaatttact
gtgatgggacgattaaacaaagccatcctccgctacctgaagaatgatgggaagattcac
ctggtggctttcaacaacctgcagctggctgatggcaggcggcacagggtcctcctgaga
ctgaccaacttacggcgaggggctggctctgtggatctctacctggactgcaagcaagtg
gattccgttcacaatctccccagagccttttctggcctctcccagaatgctgagtccgtt
gaattgaggactttccagaggaaggcacaggacttcttggaagagctgaagctggtggtg
cgaggctcgctgttccaggtcgccagcctgcaagactgcttcctgcagcagagtgagccg
ctggccgccacgagcacaggagactttaatcgtcaattcttggggcaaatgacacaacta
aaccagctcctgggagaggtgaaggatcttctgagacagcaggtcaaggaaacaacgttt
ttgcgaaacaccatagctgaatgccaggcttgcggtcctctcagctttcagtctccgacc
ccgaacacactggtgccccccgcacccccagcacctccgacacccccaatgcgccggtgt
gattccaacccatgtttccgtggcgtccgctgtaccaacaccagagatggctttcagtgt
gggccctgtcccgagggctacacgggaaatggggttacctgttctgatgttgatgagtgc
aaatatcatccctgctacccgggcgtgcgctgcgtgaacttggcgcccggcttcagatgt
gacgcctgcccagtgggcttctcagggccggtgttgcagggtgttgggatcagttttgcc
aagtcaaacaagcaggtctgcgctgatattgatgagtgtcgaaatggagcatgcgttctc
aattccatctgtgttaacactttggggtcttatcgctgtgggccttgtaaaccagggtac
actggcgatcagacaaggggatgcaaaattgaaagaaactgcaggaatccagaactgaat
ccttgcagcgtgaacgcgcagtgcatcgaagggaggcagggggatgtgacgtgcgtgtgc
ggagtcggttgggctggtgatggatacatctgtggaaaggatgtggacatcgacagttac
cctgatgaggaactgccatgctctgccaggaactgtaagaaggacaactgcaagtatgtg
ccaaattctggccaagaagatgcagacagagatggcattggagatgcttgtgatgaggat
gctgatggagatggggtcctgaatgagcaggataactgtgtcctgactcacaacatggac
caaaggaacagtgacaaagatatctttggggatgcctgtgataactgccggaatgtccta
aataatgaccagaaagacactgatggggatggaaaaggggatgcctgtgatgatgacatg
gatggcgatggaataaaaaacattctggacaactgccccaaagctcccaatcgtgaccaa
caggacaaggatggtgatggcgtgggggatgcctgcgacagttgtcctgatgtcagcaac
cctaaccagtctgatgtggataacgacctggttggggactcctgtgacaccaaccaggac
agtgacggagacgggcaccaggacagtacagacaactgccccactgtcattaacagtgcc
cagctggacactgacaaggatggaattggtgacgagtgtgatgatgacgatgacaatgat
ggcatcccagacctggtgccccctggaccagacaactgccggctggtccccaacccagcc
caggaggatagcaacagagacggtgtgggagacatctgtgagacagactttgaccaggac
caggtcatcgactggatcgacgtctgcccagagaacgcggaggtcaccctgaccgacttc
agggcctaccagactgtggtcctggaccctgaaggcgacgcccagatcgatcccaactgg
gtggtcctgaaccagggcatggagatcgtgcagaccatgaacagtgaccccggcctggca
gtggggtacaccgcttttaatggagttgactttgaggggaccttccacgtaaacacccag
acggacgatgattatgccggctttatctttggttaccaagacagctccagcttctacgtg
gtcatgtggaagcagacagagcagacgtattggcaggccaccccgttccgagctgttgca
gaacctggcattcagcttaaggccgtgaagtctcagacaggtccaggggagcatctccgc
aactccctgtggcacactggggacaccagcgaccaggtgaggctgctgtggaaggactcc
aggaacgtgggctggaaggacaaggtatcctaccgctggttcctgcaacaccggccccag
gtgggctacatcagggtacgattttatgaaggctccgagttggtggctgactccggggtc
accatcgacaccaccatgcgtggaggccggcttggcgtcttctgcttctcccaagaaaac
atcatttggtccaacctcaagtatcgctgcaatgacaccatcccagaggacttccaagag
tttcaaacccagaatttcgatcgcctggataattaa

DBGET integrated database retrieval system