KEGG   Equus caballus (horse): 100073261Help
Entry
100073261         CDS       T01058                                 

Gene name
THBS4
Definition
thrombospondin 4
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
ecb  Equus caballus (horse)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100073261 (THBS4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100073261 (THBS4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100073261 (THBS4)
  Cellular commiunity
   04510 Focal adhesion
    100073261 (THBS4)
 Human Diseases
  Infectious diseases
   05144 Malaria
    100073261 (THBS4)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100073261 (THBS4)
  Exosomal proteins of colorectal cancer cells
   100073261 (THBS4)
  Exosomal proteins of bladder cancer cells
   100073261 (THBS4)
Heparan sulfate/heparin binding proteins [BR:ecb00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100073261 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 951 aa AA seqDB search
MFAPKLNLSLIIPFFTFSPVFDLLPSSSQRLNPAVLKPILTDPTLNELYVIFTFKLQTRS
SATVFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKIHLVAFNNLQLADGRRHRVLLR
LTNLRRGAGSVDLYLDCKQVDSVHNLPRAFSGLSQNAESVELRTFQRKAQDFLEELKLVV
RGSLFQVASLQDCFLQQSEPLAATSTGDFNRQFLGQMTQLNQLLGEVKDLLRQQVKETTF
LRNTIAECQACGPLSFQSPTPNTLVPPAPPAPPTPPMRRCDSNPCFRGVRCTNTRDGFQC
GPCPEGYTGNGVTCSDVDECKYHPCYPGVRCVNLAPGFRCDACPVGFSGPVLQGVGISFA
KSNKQVCADIDECRNGACVLNSICVNTLGSYRCGPCKPGYTGDQTRGCKIERNCRNPELN
PCSVNAQCIEGRQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSARNCKKDNCKYV
PNSGQEDADRDGIGDACDEDADGDGVLNEQDNCVLTHNMDQRNSDKDIFGDACDNCRNVL
NNDQKDTDGDGKGDACDDDMDGDGIKNILDNCPKAPNRDQQDKDGDGVGDACDSCPDVSN
PNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDND
GIPDLVPPGPDNCRLVPNPAQEDSNRDGVGDICETDFDQDQVIDWIDVCPENAEVTLTDF
RAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQ
TDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSQTGPGEHLR
NSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGV
TIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLDN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccccaaagttaaatctttcactgattatccctttcttcacattctccccagtc
tttgaccttctgccatcctccagccagaggctgaatcctgctgtcctgaagccaatcctg
acagaccccaccctgaacgagctgtatgtgatcttcaccttcaagctgcagaccaggagc
tcagccaccgtctttggcctttactcttcgactgacaacagcaaatattttgaatttact
gtgatgggacgattaaacaaagccatcctccgctacctgaagaatgatgggaagattcac
ctggtggctttcaacaacctgcagctggctgatggcaggcggcacagggtcctcctgaga
ctgaccaacttacggcgaggggctggctctgtggatctctacctggactgcaagcaagtg
gattccgttcacaatctccccagagccttttctggcctctcccagaatgctgagtccgtt
gaattgaggactttccagaggaaggcacaggacttcttggaagagctgaagctggtggtg
cgaggctcgctgttccaggtcgccagcctgcaagactgcttcctgcagcagagtgagccg
ctggccgccacgagcacaggagactttaatcgtcaattcttggggcaaatgacacaacta
aaccagctcctgggagaggtgaaggatcttctgagacagcaggtcaaggaaacaacgttt
ttgcgaaacaccatagctgaatgccaggcttgcggtcctctcagctttcagtctccgacc
ccgaacacactggtgccccccgcacccccagcacctccgacacccccaatgcgccggtgt
gattccaacccatgtttccgtggcgtccgctgtaccaacaccagagatggctttcagtgt
gggccctgtcccgagggctacacgggaaatggggttacctgttctgatgttgatgagtgc
aaatatcatccctgctacccgggcgtgcgctgcgtgaacttggcgcccggcttcagatgt
gacgcctgcccagtgggcttctcagggccggtgttgcagggtgttgggatcagttttgcc
aagtcaaacaagcaggtctgcgctgatattgatgagtgtcgaaatggagcatgcgttctc
aattccatctgtgttaacactttggggtcttatcgctgtgggccttgtaaaccagggtac
actggcgatcagacaaggggatgcaaaattgaaagaaactgcaggaatccagaactgaat
ccttgcagcgtgaacgcgcagtgcatcgaagggaggcagggggatgtgacgtgcgtgtgc
ggagtcggttgggctggtgatggatacatctgtggaaaggatgtggacatcgacagttac
cctgatgaggaactgccatgctctgccaggaactgtaagaaggacaactgcaagtatgtg
ccaaattctggccaagaagatgcagacagagatggcattggagatgcttgtgatgaggat
gctgatggagatggggtcctgaatgagcaggataactgtgtcctgactcacaacatggac
caaaggaacagtgacaaagatatctttggggatgcctgtgataactgccggaatgtccta
aataatgaccagaaagacactgatggggatggaaaaggggatgcctgtgatgatgacatg
gatggcgatggaataaaaaacattctggacaactgccccaaagctcccaatcgtgaccaa
caggacaaggatggtgatggcgtgggggatgcctgcgacagttgtcctgatgtcagcaac
cctaaccagtctgatgtggataacgacctggttggggactcctgtgacaccaaccaggac
agtgacggagacgggcaccaggacagtacagacaactgccccactgtcattaacagtgcc
cagctggacactgacaaggatggaattggtgacgagtgtgatgatgacgatgacaatgat
ggcatcccagacctggtgccccctggaccagacaactgccggctggtccccaacccagcc
caggaggatagcaacagagacggtgtgggagacatctgtgagacagactttgaccaggac
caggtcatcgactggatcgacgtctgcccagagaacgcggaggtcaccctgaccgacttc
agggcctaccagactgtggtcctggaccctgaaggcgacgcccagatcgatcccaactgg
gtggtcctgaaccagggcatggagatcgtgcagaccatgaacagtgaccccggcctggca
gtggggtacaccgcttttaatggagttgactttgaggggaccttccacgtaaacacccag
acggacgatgattatgccggctttatctttggttaccaagacagctccagcttctacgtg
gtcatgtggaagcagacagagcagacgtattggcaggccaccccgttccgagctgttgca
gaacctggcattcagcttaaggccgtgaagtctcagacaggtccaggggagcatctccgc
aactccctgtggcacactggggacaccagcgaccaggtgaggctgctgtggaaggactcc
aggaacgtgggctggaaggacaaggtatcctaccgctggttcctgcaacaccggccccag
gtgggctacatcagggtacgattttatgaaggctccgagttggtggctgactccggggtc
accatcgacaccaccatgcgtggaggccggcttggcgtcttctgcttctcccaagaaaac
atcatttggtccaacctcaagtatcgctgcaatgacaccatcccagaggacttccaagag
tttcaaacccagaatttcgatcgcctggataattaa

DBGET integrated database retrieval system